KEGG   Pieris rapae (cabbage white): 110993439Help
Entry
110993439         CDS       T05162                                 

Definition
(RefSeq) cyclin-dependent kinase 6
  KO
K02089  cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
prap  Pieris rapae (cabbage white)
Pathway
prap04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:prap00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110993439
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:prap01001]
    110993439
Enzymes [BR:prap01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     110993439
Protein kinases [BR:prap01001]
 Serine/threonine kinases: CMGC group
  CDK family
   110993439
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kdo Haspin_kinase Kinase-like RIO1 Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 110993439
NCBI-ProteinID: XP_022115398
Position
Unknown
AA seq 323 aa AA seqDB search
MSRPSASNIPNMASINDVSALFQTAKKYEELNVIGTGAYGTVYKARDLHNGGQIVAMKKV
KVALTEDGIPLSTLREIALLRQLEAYQHPNIVRLIDVCHGGQSLKRESQLVLFLVFEHVE
QDLESYLKKAPGPLGDNKIRRMSYDILSGTDFLHSHRIVHRDLKPHNLLVTSSGCVKLAD
FGLAKTYDTDMKLTSVVVTLWYRPPEVLLGVSYNTAVDVWSCACVLAQLHTRSPLLPGTC
DSDQLHCIFKLIGRPPKHEWPDNVSVMADSFPDYPPLDLGIVLHRIHPQALDLIQRMLVF
NPAKRLTALDCLEHPYFTDEPLD
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgtctagaccaagtgccagtaatataccaaacatggcatcaattaatgatgtcagtgct
ttatttcaaacagctaaaaaatatgaagaattaaatgtaatcggcacaggtgcatatgga
acagtttacaaagcacgtgatcttcacaatggtggtcaaatagttgctatgaagaaagtt
aaagtcgcattaactgaagatggaataccattatcaacattaagagagattgcactatta
agacaattggaggcatatcaacatccaaatattgtcaggttaatcgacgtgtgccatggc
ggtcagtcgttgaaacgtgaaagtcagctggtactattcctggtttttgaacatgttgag
caggatttggagtcatatttgaagaaggcacctggaccactcggggataataagattagg
agaatgtcgtatgatatactgtcagggacggactttcttcattcgcatcgcatcgtccat
cgggatctgaagccccacaatcttctggtgacgtcatcgggttgtgtcaaactcgcggat
ttcggtctagctaagacatatgacaccgatatgaagcttactagcgtggtggtcacactg
tggtatagaccgccggaagtgcttttaggtgtttcgtataatacggctgtggatgtgtgg
tcatgcgcgtgtgtccttgcgcaattgcacacgcgttcgcctttgttacctggaacctgt
gattcagatcaactgcattgtattttcaaattaataggccggccgccaaaacacgaatgg
ccggataatgtgtcggtaatggctgatagttttcccgactaccctccgttggacttaggc
attgtgttgcataggatacacccgcaggctctagatcttattcaaagaatgctggtcttc
aaccccgcgaagcggctaacagcactggactgcttggaacacccctacttcaccgacgag
ccactcgactaa

DBGET integrated database retrieval system