KEGG   Pieris rapae (cabbage white): 110993483Help
Entry
110993483         CDS       T05162                                 

Definition
(RefSeq) probable glutamate--tRNA ligase, mitochondrial isoform X1
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
prap  Pieris rapae (cabbage white)
Pathway
prap00860  Porphyrin and chlorophyll metabolism
prap00970  Aminoacyl-tRNA biosynthesis
prap01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:prap00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    110993483
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    110993483
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:prap01007]
    110993483
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:prap03016]
    110993483
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:prap02048]
    110993483
Enzymes [BR:prap01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     110993483
Amino acid related enzymes [BR:prap01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   110993483
Transfer RNA biogenesis [BR:prap03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    110993483
 Prokaryotic type
   Other AARSs
    110993483
Prokaryotic defense system [BR:prap02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    110993483
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1c HSCB_C
Motif
Other DBs
NCBI-GeneID: 110993483
NCBI-ProteinID: XP_022115463
Position
Unknown
AA seq 507 aa AA seqDB search
MWGIWSTTFNGLHLSLVKQNGIRSIKTLVPRVRFAPSPTGYLHLGGLRTALYNKLFAKSR
RGAFVLRIEDTDQSRKVDGSIEALIQDLAWAGIECNEGPKQGGKYGPYIQSKRLHIYQEY
IKKLLDNGSAYRCFCTERRLNILRRNAVKSQQVPKYDNKCRNLSVEVVNEKIKSGIPYCI
RFKLSSDCLSFDDLIFGTIAYDVSLVEGDPVLVKTDGYPTYHFANVVDDHLMDITHVLRG
VEWQISTTKHLLIYRAFGWTPPQFGHLPLIVNADGTKLSKRQNDVRVEDYRDKGVYPLAL
VNFITLSGGGFQHVPGEGVRLKTMDELAQEFQINKISAHPSRLNPDLLQECNRLEIKRQI
QDPTLSSQLVAKLQLLIKEKYKTENLNIADDHIKSVLLWATSRINKIEDLVSSKFGFLWI
LPSSKSEVDEMLLHEVVENLENLEDFNENSIKERLREISSKNCVKFPELMKMLRSVLSGL
SEGPSVAEMMQLLGKCQTIERIKAVNR
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgtggggtatctggtctactacatttaatggattacatctttctttggttaaacaaaat
ggtattagaagcataaagacactagttccaagagttaggttcgctcctagtcctacggga
tatttacatttaggaggtttaaggacagctttatataataaattatttgcaaagtcacga
cgtggtgcttttgttttacgaatagaggatacagatcaaagtagaaaggtagatgggtcc
atagaggcactcattcaagatttagcttgggcgggcatagaatgtaatgaaggtccaaag
cagggtggaaaatatggaccttatattcaaagcaaacgcttacatatatatcaagaatat
attaaaaagctattggacaatggatcagcatacagatgcttctgtactgagcggagatta
aatattttaagacggaatgctgtgaaaagccaacaggtacctaaatatgataacaaatgc
aggaatttgtcagttgaagtagttaatgagaaaatcaaatcaggaattccttattgtatt
aggttcaagctgtcttctgattgtctatcatttgacgatcttatatttggtactatagct
tatgatgtatcattagtagaaggtgatccagtccttgtaaaaactgatggatatccaacc
tatcactttgcaaatgttgttgatgaccatttaatggatattacgcatgtgctgcgtggt
gtggaatggcagatatcaactactaaacatttacttatttatagagcatttggttggaca
ccgccacaattcggtcatttgccacttatcgtgaatgctgacggaactaaattaagtaaa
agacaaaacgatgttcgtgttgaagattatagagataaaggagtttacccgctggccctg
gtgaatttcataacattatcgggtggtggcttccagcatgtgcccggggaaggggttcga
cttaaaactatggacgagttagcacaagagttccagattaacaaaatatctgcacatccc
agtcggcttaatccggatttattacaggagtgtaatagattagaaataaaacgtcagata
caagacccgactctgtcatcacaattagtggctaaactccaattattaataaaagaaaag
tataaaacagaaaacctcaatatcgctgatgatcacattaaaagtgttttactatgggcg
acttcaagaatcaacaaaatagaagatttggtttcaagcaaatttggctttttatggatt
ctaccttcaagcaaaagcgaagtcgatgaaatgctactgcatgaagttgttgaaaatttg
gaaaatttagaagattttaacgaaaactcaattaaggagaggttacgtgagatttcttct
aagaattgtgtaaaatttccagaattaatgaaaatgctcagatccgttttaagtgggttg
agtgaagggccgagtgtagcggaaatgatgcaattgttaggtaaatgtcaaacgattgaa
agaataaaggctgttaatagataa

DBGET integrated database retrieval system