KEGG   Pieris rapae (cabbage white): 110993516Help
Entry
110993516         CDS       T05162                                 

Definition
(RefSeq) heat shock protein 68-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
prap  Pieris rapae (cabbage white)
Pathway
prap03040  Spliceosome
prap04141  Protein processing in endoplasmic reticulum
prap04144  Endocytosis
prap04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:prap00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    110993516
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    110993516
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110993516
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    110993516
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:prap01009]
    110993516
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:prap03041]
    110993516
   03009 Ribosome biogenesis [BR:prap03009]
    110993516
   03110 Chaperones and folding catalysts [BR:prap03110]
    110993516
   04131 Membrane trafficking [BR:prap04131]
    110993516
   03051 Proteasome [BR:prap03051]
    110993516
   03029 Mitochondrial biogenesis [BR:prap03029]
    110993516
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:prap04147]
    110993516
Protein phosphatases and associated proteins [BR:prap01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     110993516
Spliceosome [BR:prap03041]
 Complex B
  Other components
   Prp19 complex
    110993516
 Complex C
   Prp19-CDC5 complex
    110993516
Ribosome biogenesis [BR:prap03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    110993516
Chaperones and folding catalysts [BR:prap03110]
 Heat shock proteins
  HSP70 / DNAK
   110993516
Membrane trafficking [BR:prap04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    110993516
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    110993516
Proteasome [BR:prap03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    110993516
Mitochondrial biogenesis [BR:prap03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    110993516
Exosome [BR:prap04147]
 Exosomal proteins
  Proteins found in most exosomes
   110993516
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C StbA DUF3153 Hydantoinase_A Zincin_2
Motif
Other DBs
NCBI-GeneID: 110993516
NCBI-ProteinID: XP_022115496
Position
Unknown
AA seq 655 aa AA seqDB search
MPAIGIDLGTTYSCVGVWQHGNVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNP
NNTVFDAKRLIGRKFDDPKIQQDMKHWPFKVVNDYGKSKIQVEFKGETKRFSPEEISSMV
LTKMKETAEAYLGSSVRDAVITVPAYFNDSQRQATKDAGAIAGINVLRIINEPTAAALAY
GLDKSLKGERNVLIFDLGGGTFDVSILTIDEGSLFEVKATAGDTHLGGEDFDNRLVNHLA
DEFFRKYKKDIRNNPRALRRLRTAAERAKRTLSSSTEATIEIDALYEGIDYYTRVSRARF
EELNSDLFRGTLEPVEKALKDAKLDKSSIHDVVLVGGSTRIPKIQSMLQNFFCGKKLNLS
INPDEAVAYGAAVQAAILSGEQHSKIQDVLLVDVAPLSLGIETAGGVMTKIIERNAKIPC
RQSQTFTTYSDNQPAVTIQVYEGERAMTKDNNLLGRFDLTGIPPAPRGVPKIDVTFDLDA
NGILNVSAKENSTGLSKNIVIKNDKGRLSQAEIDRMLAEAERYKEEDNRQRERVAARNQL
ESYIFSVKQALDDAGEKLGQEDKNTALNACDEALKWFENNTLAEKEEYEHKLKELQRTCS
PIMSKMHNVGSSNPGGFQPGQGFQQGQGFQQGPGFQPGQGYQQYSNQGPTVEEVD
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atgccagctattggaattgatcttggaaccacatactcatgtgtgggagtgtggcaacat
ggaaacgtggaaattatcgcaaacgaccaaggcaaccgaacaacaccatcatacgttgcg
tttacagacacagagagacttattggagatgccgctaagaaccaggtcgctttgaacccg
aataatacagtgttcgacgcaaagcgactaataggcagaaaattcgacgaccccaagatt
cagcaagatatgaaacactggcctttcaaagttgtcaacgactatggcaaatctaaaatt
caggtggaattcaagggcgaaacaaaacgattttctccggaagaaatcagcagcatggtc
ctgacgaagatgaaggaaactgctgaggcgtatttgggtagttcggtcagagacgctgtt
ataacggtaccagcttacttcaacgactcccagcgccaagcaacaaaggatgcgggtgcg
attgccggtatcaacgttttaagaataattaatgaacccaccgctgccgctttggcttat
ggcctggacaaaagtctgaaaggagagcgtaacgtcttgatttttgatctcggcggcggt
acctttgatgtatccatcttaactatcgacgagggatctttgtttgaagttaaagctact
gccggcgatacgcatctcggcggtgaggactttgacaacagactagtcaaccacctggca
gatgaattcttccgaaagtataagaaggatataaggaataaccctcgcgctcttcgtcga
ctacgaaccgctgctgaaagagctaaacggaccttatcatcgagcacggaagccaccatt
gaaatagacgctctctacgaaggaattgactactacaccagggtttctcgcgcacggttt
gaggaattaaactctgatttgttccgcggtactctggaaccagtcgagaaggccctcaag
gatgctaaacttgacaaaagctctattcacgatgtagtattagtgggcggttccactcgt
attccaaaaattcaaagcatgctgcaaaacttcttctgtggtaagaaattgaacctctcc
atcaatcccgatgaagcagttgcctatggcgctgcggttcaagcagctatcttaagtggg
gaacagcacagtaaaattcaggatgtactgctagtagatgttgctccattgtcattgggt
attgagactgcaggaggagtaatgacgaagatcattgagcggaatgcgaagattccatgc
agacagtcgcaaaccttcaccacatactcggacaaccaaccagccgttaccatccaggtg
tacgagggtgagcgagctatgactaaagacaacaatctgctcgggcgatttgatcttact
ggaatacctccagctccacgaggagtacctaagattgatgttaccttcgatttggatgcc
aatggaatcttaaacgtgtccgcgaaagaaaatagtaccggcctaagcaagaacatagtg
atcaagaatgataagggtcgcctttcgcaagctgagatcgaccgcatgttggctgaagcc
gaaaggtacaaagaagaagataaccgccaaagagaaagagtagcagctcgtaatcaacta
gaatcctacatctttagtgtgaaacaggctttggacgatgctggtgaaaaactaggtcaa
gaagataagaacacagctctaaatgcgtgtgatgaagctctcaagtggttcgaaaacaat
accttagcggaaaaagaagaatatgaacacaagcttaaggaattacaaagaacttgttct
ccaataatgagcaagatgcacaatgtcggttccagtaacccaggtggcttccagcccgga
caaggatttcaacaagggcaaggattccagcaaggacccggttttcaaccaggacaaggc
taccaacaatacagcaaccaaggccccacagtagaagaagtagattaa

DBGET integrated database retrieval system