KEGG   Pieris rapae (cabbage white): 110993549Help
Entry
110993549         CDS       T05162                                 

Definition
(RefSeq) L-xylulose reductase-like
  KO
K03331  L-xylulose reductase [EC:1.1.1.10]
Organism
prap  Pieris rapae (cabbage white)
Pathway
prap00040  Pentose and glucuronate interconversions
prap01100  Metabolic pathways
Module
prap_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:prap00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    110993549
Enzymes [BR:prap01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.10  L-xylulose reductase
     110993549
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase NAD_binding_10 ApbA RmlD_sub_bind Shikimate_DH 2-Hacid_dh_C THF_DHG_CYH_C Sacchrp_dh_NADP Methyltransf_34 FMO-like
Motif
Other DBs
NCBI-GeneID: 110993549
NCBI-ProteinID: XP_022115542
Position
Unknown
AA seq 244 aa AA seqDB search
MAESFKGKRVLVTGAGQGIGRAIAIDLWRAGAKVVALSRTRSHLESLQNEYPSIAIVDVD
VADWEKTRNVVESLGHFDALVNNAAVAVCQPFLDCTPDAFDLMSNVNVKSIINISQIVAK
KMIENKTKGAIVNISSQASKAALKDHTIYSASKAGLDAITRAMALELGPYGIRTNAVNPT
VTMTAMAQVGWSDPEKADAMLSKIPLGRFAQVSEVSDVVLYLLSDKASMINGVEVPIDGG
FLAT
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atggcagaatcttttaaaggaaaaagagtgcttgtaacgggagctggacaagggattggt
cgtgccatagccatagacttatggcgcgccggcgcaaaagttgtggctctatccagaaca
cgatctcatctcgagagcctacagaatgagtacccatccatagctatagtcgatgtagac
gtggctgactgggagaaaactagaaatgtagtggaatccctggggcacttcgacgctctg
gttaacaatgcagctgttgcagtatgtcaaccatttctggactgtacgccagatgctttc
gatctgatgtctaatgtgaacgtaaagtcgatcattaatattagtcaaattgttgctaag
aagatgatagagaataagacaaaaggagctattgtgaacatttcttctcaggcctcgaag
gctgcgttaaaagatcacactatatactcagcttcaaaagctggtttggatgcaattact
cgggccatggcgttggagctagggccgtatggtattagaacaaatgctgttaatcctaca
gtgaccatgactgcaatggcgcaagttgggtggtcggatcctgaaaaagctgacgctatg
ctatcgaagatacctcttggaagatttgcacaagtatctgaggtatcagatgtggtactg
tacctactcagtgacaaagcaagcatgataaacggcgtagaagtgcccattgatggagga
tttttagcaacataa

DBGET integrated database retrieval system