KEGG   Pieris rapae (cabbage white): 110994348Help
Entry
110994348         CDS       T05162                                 

Definition
(RefSeq) uncharacterized protein LOC110994348
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
prap  Pieris rapae (cabbage white)
Pathway
prap00230  Purine metabolism
prap00240  Pyrimidine metabolism
prap00983  Drug metabolism - other enzymes
prap01100  Metabolic pathways
Module
prap_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
prap_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
prap_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:prap00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    110994348
   00240 Pyrimidine metabolism
    110994348
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    110994348
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:prap04131]
    110994348
Enzymes [BR:prap01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     110994348
Membrane trafficking [BR:prap04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    110994348
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NDK DUF1126
Motif
Other DBs
NCBI-GeneID: 110994348
NCBI-ProteinID: XP_022116632
Position
Unknown
AA seq 206 aa AA seqDB search
MYDEEGDEIVELVLNFFPFDNSVQIINTKKGKTLLRRVQLPSLKLEMLQIGNVVNIFSKL
LNITDCAPLTRRTLFKNVESTFALIKPIPPSEHGKILTFIMKNGFRIVRMKNGKISKDFA
IILYHNISGSNMMPIIIDYITSGEVIGLELVAPDAVKKWRKCLGATDPSEAAPGTLRNLY
GENTLKNIAHGCNTLEDATQVCPLIT
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgtatgatgaagaaggagacgagatcgtggaattagttcttaattttttccctttcgat
aattctgtacaaataatcaacacgaaaaagggtaaaactcttttgagacgcgtacaattg
ccttcattaaaattagaaatgcttcaaataggtaatgttgtgaatatattttcaaaatta
cttaacatcaccgactgtgcacctttgactcgaagaactctttttaaaaatgtggaaagt
acttttgctttgataaaacccatcccaccaagcgaacatggcaaaattttaacattcatc
atgaaaaacggatttcgaattgttcgtatgaaaaatggcaagatcagcaaggactttgca
attatactgtaccataacatttcgggaagcaatatgatgccaataataatagactacatc
acgagcggagaggttattggcctagaactggttgctcctgatgctgtaaaaaaatggcgc
aaatgtttaggggcaaccgacccatcagaagctgctccaggaactttacgtaatttgtat
ggagaaaatacactaaaaaacattgctcatggttgtaatactttagaggatgcaacccaa
gtatgtccgttaattacgtaa

DBGET integrated database retrieval system