KEGG   Pieris rapae (cabbage white): 110995297Help
Entry
110995297         CDS       T05162                                 

Definition
(RefSeq) autophagy-related protein 16 isoform X1
  KO
K17890  autophagy-related protein 16-1
Organism
prap  Pieris rapae (cabbage white)
Pathway
prap04136  Autophagy - other
prap04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:prap00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110995297
   04136 Autophagy - other
    110995297
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:prap04131]
    110995297
   03029 Mitochondrial biogenesis [BR:prap03029]
    110995297
Membrane trafficking [BR:prap04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    110995297
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    110995297
Mitochondrial biogenesis [BR:prap03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    110995297
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATG16 WD40 ANAPC4_WD40 eIF2A MPS2 DUF4201 LRRFIP Lebercilin FAM76 HOOK UPF0242 PspA_IM30 KASH_CCD DUF724 HAUS-augmin3 Fez1
Motif
Other DBs
NCBI-GeneID: 110995297
NCBI-ProteinID: XP_022118073
Position
Unknown
AA seq 567 aa AA seqDB search
MEGGEWRNNIINQLRARNKRETFAFQDIFTFQSRLFDNVNTLKNENLQLTLVNERIRFSN
TESVSSGGGAVNEKIQALEQKILSQQEELTSLHRRRGESSQQIINLNAKVHDLEKNLQAK
DIIISENTALIASLRAEIQMYENNMTELQGLNQVLRDEHQALQIAFAAIEDKLRKAQDEN
RSLVERLIKYKAKDADKMNEENEHFLKSSNPTAFLINTFGRVSFGKKSDKVKKELEEAAR
EGGSRSSGSGGSDDKIMDSLPYYATSLPSKVALRFDAHDGEVNAVKWSPTDRIVATGGAD
RKVKLWDVSKLGTSENRGTLVGSNAGVMSVDFDSTGAFIVGASNDFASRVWTVGDQRLRH
TLTGHSGKVMAAKFLGEPSKVITGSHDRTLKIWDLRSRMCTETKFAGSSCNDLVTSDGAG
STIISGHFDKRIRFWDIRTEMSANHIVLQGKVTSLDLSRDSNYLLACVRDDTIQLIDLRM
NTIVRSFSHDAFKVGCDWSRAAFGPGGRLLAVGAADGAAYVWNTHSGKLEAVLKDHSTAV
TAVSWHPQSGLLASVDRAKRAVIWGDL
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atggaaggtggcgagtggagaaataatataataaatcagctacgagctcgaaacaaaagg
gaaacttttgcgtttcaggatatttttacatttcagagccggttatttgataatgtaaac
acacttaaaaatgaaaatttacagctgactttagtcaatgagagaataagattttctaac
acagaaagtgtgtcttctggaggaggtgctgttaatgaaaagatacaagccctagaacaa
aaaattttaagccagcaagaagagttgacatcattacacaggagacgaggagagagctcg
caacaaataataaacttaaatgctaaagtacatgatttagagaagaacttacaagctaaa
gatatcataatttcagaaaacacagctcttattgcatcacttcgggctgaaattcagatg
tatgaaaataatatgacagagttacaaggacttaatcaggttttaagagatgaacatcaa
gcactacaaatagcatttgcagctattgaagacaaattacggaaagctcaggatgaaaac
cgttcgctagtggagagattgataaagtacaaggcgaaagatgctgacaaaatgaatgaa
gaaaacgaacattttcttaagtcaagcaaccctactgcgtttttgatcaacacatttggt
agagttagtttcggaaaaaagagtgataaagttaaaaaagagttggaggaagcagcaaga
gaaggcgggagtagaagcagtggttctggtggtagtgacgataaaattatggattctctg
ccgtattatgcaacgtctctaccgagtaaagttgctttgagatttgatgctcatgatggc
gaagtgaatgctgttaagtggagtccaactgatagaattgttgctacaggcggagctgac
aggaaagttaaattatgggatgtgtctaagttgggtacatcggaaaacagaggtaccctc
gtcggttcaaatgctggtgtgatgtcagtggacttcgattcaactggtgccttcattgtc
ggagcttcgaatgacttcgcgagtcgggtgtggactgttggtgaccaacgattaaggcat
acgctaactgggcacagtgggaaagttatggcagccaaattcctgggagagccttcaaaa
gttatcaccggaagtcatgataggactttgaaaatatgggatcttaggagtaggatgtgt
acagaaaccaaattcgcgggatcatcttgcaatgacctcgtgacgtcagacggcgccggt
tcgaccatcatttcaggacacttcgataagcggatacgattttgggacatacgaacagaa
atgtcagccaatcacattgtgcttcagggcaaagtcacctcactcgatctcagtagagat
agtaattatttattagcgtgcgtacgagatgacacaatacaactcatagacttaagaatg
aatactattgtgcggtccttcagccacgatgctttcaaagtgggttgcgattggtcgcgc
gccgccttcggcccgggcgggcggcttctcgcggtgggcgcggcggacggtgccgcctac
gtatggaatacacattccggcaaactagaagcagtactcaaagatcactcaactgcagtg
acagccgtgtcgtggcacccgcagtcgggtctcctcgcatcagtggatcgcgcgaagcga
gccgtcatttggggtgatttgtga

DBGET integrated database retrieval system