KEGG   Pieris rapae (cabbage white): 110995372Help
Entry
110995372         CDS       T05162                                 

Definition
(RefSeq) pseudouridine-5'-phosphatase-like
  KO
K17623  pseudouridine 5'-phosphatase [EC:3.1.3.96]
Organism
prap  Pieris rapae (cabbage white)
Brite
KEGG Orthology (KO) [BR:prap00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:prap01009]
    110995372
Enzymes [BR:prap01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.96  pseudouridine 5'-phosphatase
     110995372
Protein phosphatases and associated proteins [BR:prap01009]
 HAD phosphatases
  Other HAD phosphatases
   110995372
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like Pollen_allerg_2 HAD
Motif
Other DBs
NCBI-GeneID: 110995372
NCBI-ProteinID: XP_022118197
Position
Unknown
AA seq 228 aa AA seqDB search
MDIKPVTHVLFDMDGLLLNTEDLYTELFQSIVSKYGKEFTFDVKLKLMGTQALESASIVI
RELDLPMTAEEFLEECKKGESIFADCQLMPGAKRLVEHFYQHKIPIALATSSGEYSYHCK
VDKHYTEFFSLFPYKTFGSSDPSVKNGKPHPDIFLVTAMKFPDKPVPEKCLVFEDAVNGV
KAAVAAGMQVVMVPDPRIDKSLTTEATLVLSSLEEFKPELFGLPPFQD
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atggatattaaacctgtaacacatgttctttttgatatggatggtctattactaaataca
gaagatttgtacactgagctgtttcaaagtatagtgtcaaagtatggaaaggaatttaca
tttgatgtaaagttaaaactaatgggaacacaagcacttgaaagtgcttcaattgttatc
agagagcttgaccttcccatgaccgcagaagagtttctagaagaatgtaaaaaaggagaa
agtatttttgctgattgccagttaatgccaggtgctaaacgacttgttgaacatttttac
caacacaaaatacccatagctttagctacaagttctggagaatatagctaccattgcaaa
gtagataaacattatacagaatttttctcattgtttccatataaaacatttggatcctca
gacccttcagtaaagaatggaaagcctcatccagacatatttttagtaacagcaatgaaa
ttccctgataaacctgtacctgaaaaatgtttagtatttgaagatgcagtaaatggtgta
aaagccgccgtcgcagctggaatgcaagttgtcatggttcccgatcctcgcatagacaaa
agtttgaccacagaggctacgcttgtgcttagttcgttagaggaatttaaaccagaactt
tttggcctaccgccatttcaggactag

DBGET integrated database retrieval system