KEGG   Pieris rapae (cabbage white): 110995657Help
Entry
110995657         CDS       T05162                                 

Definition
(RefSeq) annexin B9-like isoform X1
  KO
K17095  annexin A7/11
Organism
prap  Pieris rapae (cabbage white)
Brite
KEGG Orthology (KO) [BR:prap00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:prap04147]
    110995657
Exosome [BR:prap04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110995657
  Exosomal proteins of other body fluids (saliva and urine)
   110995657
  Exosomal proteins of colorectal cancer cells
   110995657
  Exosomal proteins of bladder cancer cells
   110995657
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Annexin SAM_MT
Motif
Other DBs
NCBI-GeneID: 110995657
NCBI-ProteinID: XP_022118611
Position
Unknown
AA seq 498 aa AA seqDB search
MNPYQGPPQYLHNIGFTNNAPQSFGNPLPMPGFPTMGYPAPQPGYPAATPGYPQSNYPTQ
GYPQQNSGYPQQNQGYLQQSQGYPQQSQGYPQQSQGYPQQSQGYSQQSQGYSQPSQGYSQ
PSQGYPQNPAQSYPGAQESAQTRYPQQGYQASGYPQSNPQAYAHSIQTHQAYGASNPIAS
MPKSKPTVVPVNPFDPRDDAAVLRKAMKGFGTDEKAIIQVLTRRSNEQRLRIAFEFKTLY
GKDLVSDLKSETSGKFEDLLVALMTPLPQFYAKELHDATAGIGTDEDVLIEVMCTMSNHE
IHVIKQAYTAMYGTLLEDDLRGDTSGNFKRLMTSLCMGNRSEDFHIDQERAREDARSLLQ
AGELRLGTDESIFNAVLCSRSFPQLAAIFQEYQFLTGHDIDDAIKAEFSGDLEKALRAIV
KVVRNKPLFFAEGLHKSMKGLGTNDRQLIRIMVTRCEVDLGDIAEMFQAKYGESLQSWIE
GDCSGHYKKCFLGLLGLY
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgaatccataccagggaccgccacaatatctacacaatattggatttacgaacaacgct
ccacaatcttttgggaatcctttgccaatgccaggattcccaacaatgggctatccggca
ccccagccgggttacccagctgcaacccctggttaccctcaatctaactatcccactcaa
ggataccctcagcagaattcagggtaccctcaacaaaatcaggggtacctccaacaatct
cagggatatccccagcaatctcagggatatccccagcaatctcagggatatccgcaacaa
tctcagggttattcccaacaatctcagggttatagccaaccatctcagggttatagccaa
ccatctcagggttatccacaaaacccagctcaatcatacccaggtgctcaagaatcggct
caaactagatatccccaacaaggataccaggcaagtggctacccacaatcaaacccacag
gcatatgctcatagtattcaaactcatcaggcttatggtgcatcaaatcccatagctagt
atgcccaagtctaaacctacagtggtgcctgtaaacccctttgatcctcgcgacgatgcg
gcagttcttaggaaggcgatgaaaggattcggtacggatgagaaggccatcatccaagta
ctgacacgtcgaagcaatgagcaacgtttgcggatagcgttcgaattcaagactctatat
ggaaaggatctcgtatcagacctgaagagtgagacaagcggaaagttcgaggaccttcta
gtggcgttgatgacgcccttgccacagttctacgccaaggagctgcatgatgcaacagct
ggtattggtacagatgaggatgtcctcattgaagtcatgtgcactatgtccaaccacgaa
attcacgtcatcaagcaggcatatacagcaatgtatggaactttgttggaggacgatctt
cgtggagatacatcaggaaacttcaagcgtctcatgacatcattgtgtatgggcaacaga
tctgaagattttcatattgatcaagagagggcgagagaagatgctagaagcctgttgcag
gcgggtgaactccgtctgggtactgacgagtcgatattcaacgctgtgctctgttcccgt
tcattcccgcaactggcggccatcttccaggagtaccagttcctgacaggacacgacatc
gatgatgccatcaaggcagagttctcgggcgaccttgagaaggcgcttcgtgctatcgtg
aaggtagttcgcaataagccgctgttcttcgcggagggtcttcacaagtctatgaagggt
cttggtactaacgacaggcaattgatccgtattatggtcacccgctgtgaggttgacctg
ggagacatcgccgagatgttccaggccaagtatggagagtctctacagagctggatcgag
ggtgactgttctggccactacaaaaagtgtttcttgggattattaggtttatactaa

DBGET integrated database retrieval system