KEGG   Pieris rapae (cabbage white): 110997850Help
Entry
110997850         CDS       T05162                                 

Definition
(RefSeq) serine/threonine-protein kinase polo isoform X1
  KO
K06631  polo-like kinase 1 [EC:2.7.11.21]
Organism
prap  Pieris rapae (cabbage white)
Pathway
prap04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:prap00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    110997850
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:prap01001]
    110997850
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:prap03036]
    110997850
Enzymes [BR:prap01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     110997850
Protein kinases [BR:prap01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   110997850
Chromosome and associated proteins [BR:prap03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     110997850
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    110997850
  Sister chromatid separation proteins
   Polo kinases
    110997850
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase POLO_box Pkinase_Tyr Kinase-like Pkinase_fungal APH Endopep_inhib
Motif
Other DBs
NCBI-GeneID: 110997850
NCBI-ProteinID: XP_022121891
Position
Unknown
AA seq 609 aa AA seqDB search
MRLYLKMTSMKEDDKKEIPDFIRDPQTGCTYQRLRFFGKGGFAKCYEMQDLATEQVWAGK
VVSKKLLVKKTQKEKTAQEISIHRSLRHKHVVGFHNFFEDSQNIYILLELCKKRSMMELH
KRRKALSEPETRFYMHQILLGVQYLHHKCIIHRDLKLGNLFLDDDLHVKIGDFGLAAKIE
YEGERKQTVCGTPNYIAPEILTKKGHSFEVDIWSLGCIMYTLLVGKPPFETSTLQDTYKR
IKKCEYNEGISMAIEVCCGPWKTLGARYAQAVINNNTLRQEYRIPSALRKPAASMIVLQL
QANPSLRPSVDKLLQHEFFSSGIMPAALPVSCLTTAPRLDQLIEGEPIHRRPLNEVNSND
MMAVDSPVKPQVPAELRAVEPTAHRKDLMTLRDQIASLLTSKLKCRPECLTDELSDPAAQ
PLVWVGKWVDYSDKYGFGYQLCDESVGVMFNDTTKLIMLANGVTVHYIDRQGKEQYMTMH
KYPSELEKKMKLLTYFRRYMTEHLMKAGASVSVRESDGLSRLPHLHQWFRTTLAVIMYLT
NGTLQINFQDHTKIILCPLMQAVTYIDVDKNFRTFRFATIEEHGCDKKLYTNLKYALEKM
NSILTNKLC
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttatatttaaaaatgacctcaatgaaagaagatgacaagaaagaaatcccggat
ttcattcgtgatccccagactggctgtacttaccaaagattacggttttttggaaagggg
ggttttgcaaaatgttacgaaatgcaagatctagctacagagcaagtatgggcgggcaaa
gttgtttccaaaaaactgcttgtgaaaaagacccaaaaagaaaaaactgctcaagagatc
tccatccatagatcacttcgacataaacatgtggtgggattccacaatttctttgaagat
tcccagaacatatatattttattggagctatgtaaaaaacggtcgatgatggaactgcac
aagaggagaaaagccttgagtgagccagaaacaaggttttacatgcaccaaatattgctt
ggtgttcagtatttgcaccataagtgcattatacacagggatctgaaactgggcaatctc
ttccttgatgacgacctgcatgttaagattggtgactttggcctagctgccaaaattgaa
tatgaaggagagagaaagcagactgtttgcggtacaccaaattacattgcacctgagatt
ttgactaagaagggacactcgtttgaagttgacatttggagcttaggttgcattatgtat
acgttgcttgtgggcaaaccgccctttgagacctccacactacaagatacatacaagaga
ataaagaagtgcgaatacaatgaggggataagcatggcaatagaggtgtgttgtggtcca
tggaaaaccctcggtgcgcgatatgcgcaagccgttatcaacaataatacacttagacaa
gaatacagaataccatcggctctccgcaagcccgctgcatcaatgatagtcctgcaactc
caagcgaacccatctcttcgtccctctgtggacaaattgcttcagcatgagttcttctca
tccgggataatgccggcggctctgccagtttcttgtttgaccacagctcctcgacttgac
cagttaattgagggtgaaccgatacacagacgaccacttaatgaagttaacagtaatgac
atgatggcggtagattcgccagtgaagccccaagtaccagcagagctccgagcagtggaa
cccaccgcccacaggaaggaccttatgacgcttcgtgaccaaattgcttcgttgctcact
agcaagctgaaatgccgtcccgagtgcctgactgacgagttaagtgaccctgcagctcaa
ccattggtgtgggtcgggaagtgggtggactatagtgacaaatatggcttcggataccaa
ttgtgtgatgaaagtgttggagtcatgttcaatgatacaaccaagcttattatgcttgct
aatggagtgaccgtccactacattgaccgacaaggcaaagagcagtatatgacaatgcac
aaatacccatcggagctggagaagaagatgaaactcttgacctacttcagaagatatatg
accgaacaccttatgaaagcaggtgcatcagtgtcagtgcgggagagtgacggtctgtct
cgattgcctcacctccaccaatggtttagaacaactctggccgttatcatgtacctgacc
aatggcacgctacagattaatttccaagaccacacaaagatcatactgtgtccactgatg
caagcggtgacatacatagacgtagacaaaaacttcagaacattcagatttgcaacgatc
gaggaacatggctgcgacaaaaaactctacacaaatctcaaatatgctttagaaaaaatg
aacagtattttaacgaacaagttgtgttaa

DBGET integrated database retrieval system