KEGG   Pieris rapae (cabbage white): 110999641Help
Entry
110999641         CDS       T05162                                 

Definition
(RefSeq) probable palmitoyltransferase ZDHHC24
  KO
K18932  palmitoyltransferase [EC:2.3.1.225]
Organism
prap  Pieris rapae (cabbage white)
Brite
KEGG Orthology (KO) [BR:prap00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    110999641
Enzymes [BR:prap01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     110999641
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC
Motif
Other DBs
NCBI-GeneID: 110999641
NCBI-ProteinID: XP_022124497
Position
Unknown
AA seq 280 aa AA seqDB search
MMLKLQFIQNKQLKRLLEHGTYLTIIFVLVPAFVYFELVVVLPATVEEWSIPYFVHLACA
TFLLMNILGNMIFGMFTDTSIKGTVLDSENKENWSLCAVCECLRPPRAWHCNTCDICILK
RDHHCTFFACCVGYYNHRYFMCFTFYIFVAMVYAFYYNVKFLAIYLKWNNGLVIGKFLFP
LACFVIDFGDETVYVFLVEINFIVAMFTGFLFFYHFNNLLKGKVTPEIKHNSKEVTYNRG
LKQNVIEVFGSRWYLVWLSPYFKSPLPGNGIEWNGEDKCK
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgatgttaaaattgcaattcattcaaaataagcaattaaaaagacttttggaacatggt
acatatcttaccataatatttgtgttagtaccagcttttgtgtattttgaattggttgta
gttctccctgcaacagtagaagaatggagtatcccatattttgtacatttagcatgtgca
acatttcttctaatgaatatattaggaaatatgatttttggaatgtttactgatacaagt
ataaaagggacagttctggattctgaaaacaaagagaattggtcactgtgtgctgtttgt
gagtgtcttaggcctcctcgagcctggcattgcaatacttgtgatatatgtatactgaaa
agagaccaccattgcaccttctttgcctgctgtgtaggttactataatcatagatatttt
atgtgttttacattttatatatttgttgcaatggtgtatgcattttattacaatgttaaa
tttttagccatatacttaaaatggaacaatggcttggttattggtaaattcctctttcct
ttggcctgttttgttatagattttggtgatgagactgtttatgtgtttcttgttgaaatc
aattttatagttgccatgtttactggattcctcttcttttatcattttaataatctttta
aagggaaaagttacacccgaaattaaacacaattctaaagaagtgacttacaatagaggc
cttaaacagaatgtaatagaagtatttgggtcaaggtggtatttggtatggttgtcgcct
tattttaaaagcccattgcccggtaatggtattgaatggaatggtgaagataagtgtaaa
tag

DBGET integrated database retrieval system