KEGG   Pieris rapae (cabbage white): 111000138Help
Entry
111000138         CDS       T05162                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1-like
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
prap  Pieris rapae (cabbage white)
Pathway
prap00010  Glycolysis / Gluconeogenesis
prap00562  Inositol phosphate metabolism
prap01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:prap00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111000138
   00562 Inositol phosphate metabolism
    111000138
Enzymes [BR:prap01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     111000138
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     111000138
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 111000138
NCBI-ProteinID: XP_022125184
Position
Unknown
AA seq 425 aa AA seqDB search
MQLIFVNLFLSCISCVIGNFCYWNTGCPYKYLSSETPYNLVRGDIRDSVVKLNGCEPVSV
WGIFRHGKRYPEASTGKTMQDAVSLRKCIISRYQRGHSSLCAQDIENLHNWQYNPAIFDD
KQDITEEGRKEMLFLGKRFREAFPNIMSDLREANFRSAKGKWLENSIKEFVKGLGNPNLV
IDPPKTAFDDIAPYLSCEKSLNNNPKMYTEIEKYLNTTDYLVVKDRIQRRTGLEKLTNDN
VSALYNLCRYTWSGIDGTTSPWCALFTKDDLQVLEYEEDLKHYYENGYGLSINEIFGGMP
LADLWRNFDRVRSGGGKKLVAYVTHAKTLDQIYTALGLFNDTNPLTARRDADRKWRSSIM
SVYSGNLVAVLNKCTNEVDDYNIVFYMNEEPIRSICADGVCSWQEFEYKFRSFVNTNFDF
CEFLN
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgcaactaatatttgtgaatttatttttgtcttgtataagttgtgttattggaaacttt
tgttattggaatactggatgtccttataaatatttatctagtgagactccatataactta
gttcggggtgatatacgagactctgttgtcaagttgaatggttgtgaaccagttagtgtt
tggggaatattcagacatggaaaacgatatcccgaggcgtccactggcaaaactatgcaa
gacgctgtgtcgttacgaaaatgtattatttcaagatatcaaaggggacacagttcattg
tgtgctcaggatatagaaaatttacacaattggcaatacaacccggcaattttcgatgac
aaacaagatatcacagaggagggccgaaaggaaatgttatttttggggaagcgatttaga
gaagcatttcctaacattatgagcgacctacgcgaggcaaacttccggtctgctaagggg
aagtggttagaaaatagtattaaggaattcgtcaaaggattgggtaatccaaacttagtt
attgatccgccgaagacagcgtttgatgatattgcgccttatttgagttgtgaaaagtcg
ctcaataacaacccgaaaatgtatacagaaatcgagaaatatttaaacacaaccgactat
cttgttgtcaaagatcgaatacaacgtcgcactggattagaaaagctgacaaacgacaat
gtatctgccttgtataatctatgccgctatacatggtctggcattgacggcacaactagt
ccctggtgcgcacttttcacaaaggacgacttgcaagtcctggaatacgaagaggactta
aagcattactacgaaaatggttatggcctatctataaatgaaatcttcggaggtatgcct
ttggcagatttgtggcggaatttcgaccgagtgagaagcggcgggggaaagaaactcgtt
gcttacgtcactcacgcgaaaaccttggatcaaatttatacagccttaggactctttaat
gatacgaatccgttaaccgcgagaagagatgcagatagaaaatggcggagtagtattatg
tctgtgtattcggggaaccttgttgctgtattaaacaagtgtacaaacgaggtggacgat
tataacatcgttttttacatgaacgaagagccaattagatcaatttgtgccgatggcgta
tgttcttggcaggagttcgaatacaaatttaggtcatttgttaatacaaatttcgatttt
tgtgaatttttaaattag

DBGET integrated database retrieval system