KEGG   Pieris rapae (cabbage white): 111001214Help
Entry
111001214         CDS       T05162                                 

Definition
(RefSeq) glucosylceramidase-like
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
prap  Pieris rapae (cabbage white)
Pathway
prap00511  Other glycan degradation
prap00600  Sphingolipid metabolism
prap01100  Metabolic pathways
prap04142  Lysosome
Brite
KEGG Orthology (KO) [BR:prap00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    111001214
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    111001214
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    111001214
Enzymes [BR:prap01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     111001214
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C
Motif
Other DBs
NCBI-GeneID: 111001214
NCBI-ProteinID: XP_022126682
Position
Unknown
AA seq 537 aa AA seqDB search
MRSLHNIALIFSFIVITKSDQKCRERDLGIEGRSIVCVCNSEYCDTITRDPPDASSYVAY
TTTRAGKRFEKSNGRIQAFSRLQKELNDFNRNEENENEGPFWTRTTLVLNQNNRYQTIHG
FGGSVTDAAAYNWNKLSERTKHNFISSYFGEDGLEYNLIRTPIGGADFSTHPYTYNEYPW
NDAALTNFTFTYEDLFLKIPMIKYIQRVSKQEVKVMASTWSPPVWMKTNEHITGFSQLKP
EFYQSFADYHVKFMELYEKAEIDIWALTTTNEPINGIIPFVTFNSLGWFPAEMGHWVGKN
LGPTIRNSRFNKTLIFAVDDQRYLLHFYLLGMENTDSDSIKYIDGIAVHYYGNFAPATIF
DELQNRYNKILLATEACEGPMPWDVMRVKLGSWERAHRYTKNIIEDLNHHVTGWIDWNLC
LDERGGPNWADNFVDAPIMVIPERDEFIKQPMFYAMGHFSKFIPRGSQRISVTYPFLEFG
RIDNVAFRTPQGNIVLVLHNSNTFEMDVRINVDAIRHIIIKVEAESIITMEINTRLF
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgcggagtctacacaatatagctttaatattcagttttattgtaataactaagagtgac
caaaaatgtcgagagcgggatctaggtatcgaaggccgatcgatagtttgtgtctgcaat
tcagaatactgtgacaccatcacgagagatccaccagacgcaagcagctacgtcgcatat
acgacaacaagggcgggaaagcgctttgagaagtcaaatggaagaattcaagcattttca
aggctacaaaaagagttgaatgattttaacagaaatgaggaaaatgaaaatgaaggtcct
ttttggacaagaactactcttgttttgaaccaaaataatcgctatcaaacaatccatggt
ttcggtggctccgtgacagatgcagcagcgtacaactggaataaattgtcagaaaggaca
aaacataattttattagttcatactttggtgaagatgggctggaatataatctcattcgt
actccgatagggggcgctgatttttccactcacccctatacctacaatgagtatccatgg
aacgatgctgcgttaaccaattttacgtttacttatgaagatttattcttaaagataccg
atgatcaaatacatccaaagagtgtcgaaacaagaggtaaaggtgatggcatccacctgg
tcacctccagtgtggatgaaaacaaatgaacacatcactggcttctcacaactgaaaccc
gagttttatcagagtttcgcagactatcacgtgaagttcatggaactatatgaaaaagca
gaaatagacatatgggcgctaacgacaacgaacgaacctatcaatggtatcatacccttc
gtcacgtttaattccttaggctggtttccagctgaaatgggtcattgggttggaaagaat
cttggtccaacaataagaaattcacgatttaataaaacattaatttttgctgtggatgat
cagcggtatctcctacatttctacttattggggatggaaaataccgacagcgactcaata
aaatacatagatggaatcgcggttcactactatggaaactttgcacctgcaaccatcttt
gatgaacttcaaaatagatacaataaaatactgttagccacagaggcttgcgaaggacca
atgccatgggatgttatgagagtgaaactagggtcttgggaacgtgctcatcgttatacc
aaaaatattatcgaggacctaaatcatcatgtaaccggttggattgactggaatctctgc
ttagatgaaagaggtggtcccaattgggccgacaacttcgtcgacgcccccataatggtc
atcccggagagagacgagttcattaaacagccaatgttctatgcaatgggccatttctct
aaatttatacctcgaggatcacaaagaatatcggttacttatccatttttggagtttgga
agaattgacaatgtcgcttttaggacgccacaaggaaatatagttttggtccttcataat
tcgaacacatttgaaatggatgtcagaataaatgttgatgccataagacatattataata
aaggttgaagctgaatctattataacaatggagataaatacaaggcttttttaa

DBGET integrated database retrieval system