KEGG   Pieris rapae (cabbage white): 111001764Help
Entry
111001764         CDS       T05162                                 

Definition
(RefSeq) aromatic-L-amino-acid decarboxylase-like
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
prap  Pieris rapae (cabbage white)
Pathway
prap00350  Tyrosine metabolism
prap00360  Phenylalanine metabolism
prap00380  Tryptophan metabolism
prap01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:prap00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    111001764
   00360 Phenylalanine metabolism
    111001764
   00380 Tryptophan metabolism
    111001764
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:prap04147]
    111001764
Enzymes [BR:prap01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     111001764
    4.1.1.105  L-tryptophan decarboxylase
     111001764
Exosome [BR:prap04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   111001764
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_1_2 SepSecS
Motif
Other DBs
NCBI-GeneID: 111001764
NCBI-ProteinID: XP_022127458
Position
Unknown
AA seq 502 aa AA seqDB search
MDSQQFREYGKAAIDFIADFYDNIREKDVLPSVEPGYLIKKLPKDAPEEPEDWKAVFKDF
TDNIVPGVTRWQSPQFHAYYPTGTSFASVVGGLLCDGLGTVGITWMAGPACTELEVVTMN
WFGKLLGLPEEFLNSSPGPGGGVIQGSASEATLVCLLAAKDKMIRRMQKLNPDLDEELTK
IKFVAYTSDQCNSSVEKSGVLGSMKMRLLKADSSGRLRGETLKKAFEEDKAKGLIPCYVV
ANLGTTGTCAFDPLYELGPVCQKYDVWLHVDAAYAGAAFICPEYRHLMKGVEYADSFDIN
AHKWLLVNFDCSAMWVKDGYDLINAFDVQRIYLEDVKGDLKIPDYRHWQMPLGRRFRSLK
LWSVLKIYGAEGLRRHIRNQISLAQHFAKLVQADGRFIVEPEPAMALVCFRLVEGDYLTK
KLLENLTEKKQIFMVGASCKGRFIIRMAICSQFTTVQDVEVSWKLVKDEADNIIKTDILH
SKSQSIASIDHLQNIDICEKSK
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggattctcaacagtttcgagagtatgggaaggcggccatcgactttatagccgatttt
tatgacaatattagagaaaaagacgttttgccttcggtagagccagggtacctcattaaa
aagttaccaaaggatgcaccggaagagccagaagattggaaagctgttttcaaagatttt
actgacaacatcgtgcctggggttacgcgatggcagtcaccacaatttcacgcttactat
cctactggaacgtccttcgccagtgttgttggtggccttctttgcgatggcttaggaaca
gttggaatcacttggatggcgggtccagcctgtacggagttggaggtcgtcacaatgaac
tggtttggaaaacttctaggtttacccgaagaattccttaacagctctcctggaccagga
ggcggcgttatccagggctctgcaagtgaagcaacgctagtttgtttactggctgccaaa
gataaaatgattcgcagaatgcaaaaattaaatcctgatttagatgaagagcttaccaaa
ataaaatttgtagcatatacctctgatcagtgcaattcatctgttgaaaagtctggagtt
ctaggctcaatgaaaatgagactactaaaagcggattccagtggcagattgcgtggagaa
acacttaaaaaggcgttcgaagaggacaaggctaaaggtcttatcccgtgctatgtcgta
gcaaacctggggacgactgggacttgcgcatttgacccattatatgaattgggacctgtt
tgtcagaaatatgatgtttggttacacgttgatgcagcctacgctggagcagcttttata
tgtcctgaatacagacatttaatgaaaggtgttgaatacgcagattcatttgatatcaat
gcacacaaatggttgctcgtaaatttcgattgttctgcaatgtgggtcaaagatggatat
gaccttattaacgcgttcgatgttcaaagaatttacctagaagatgttaaaggggactta
aaaattccagattaccgtcactggcagatgccattgggtcgacggtttagatcattaaaa
ctgtggtcggttcttaaaatatatggcgctgagggattacgtagacacattagaaatcag
attagccttgctcaacactttgctaaattggttcaagctgatggtagatttatagttgaa
ccagaaccagctatggcattggtgtgctttagattggttgaaggcgattatctcaccaag
aagttactcgaaaatttaactgagaaaaaacaaatctttatggtaggcgcttcttgtaaa
ggtcgctttataatacgcatggctatttgctcgcaatttactacagtgcaagatgtagaa
gtaagctggaagttggtgaaagacgaagccgataatataattaaaaccgatatattacat
tctaaatctcaatcaattgcatctattgatcacctgcaaaatatagatatatgtgagaaa
tccaaatag

DBGET integrated database retrieval system