KEGG   Pieris rapae (cabbage white): 111002908Help
Entry
111002908         CDS       T05162                                 

Definition
(RefSeq) ornithine carbamoyltransferase, mitochondrial-like
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
prap  Pieris rapae (cabbage white)
Pathway
prap00220  Arginine biosynthesis
prap01100  Metabolic pathways
prap01230  Biosynthesis of amino acids
Module
prap_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:prap00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    111002908
Enzymes [BR:prap01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     111002908
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OTCace OTCace_N
Motif
Other DBs
NCBI-GeneID: 111002908
NCBI-ProteinID: XP_022128887
Position
Unknown
AA seq 323 aa AA seqDB search
MNFLTIKLCNHVITHTMRSIQNCCIGSTPKHLICFKDWTGDMIMEIINSALRLKCNLIDT
HGKRLDLLENSKIMILQEVNAPVLNMAVSKAATLLGADAVNIVDRLIWNHDYNGRVFSFM
ADAIFVATSTHTCLQRFAKQSLVPVICMTSRTHSTIQAMATIMTIIEEFGTIRKLNIAYF
GSPHPVLNSYLLLCPILGANIKFKCSCSKQPVSPLLYKAGETLCSQSHTSLEACTDKNKA
LCKADVIIAGPENAKKLSEFKLCYQDIEKLACPSWIFLHTCPRGKEVDDNLFFHDRARTF
IAFENFQYIAAALMASTIKDHTF
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaattttttgacaataaaattatgtaaccatgttattacacatactatgaggagtatt
caaaattgttgcattggatctacccctaaacatctcatttgcttcaaagactggactggt
gatatgattatggaaataataaacagcgcactaagattaaagtgtaatttaattgacaca
catggaaagcgattggatttgttggaaaattcaaagataatgatactacaagaagtcaat
gcaccagtgttaaatatggctgtctctaaagcagcaactttacttggcgctgatgctgtt
aatattgtagatcgactaatttggaaccatgattataatggccgagtattttcatttatg
gcggatgcgattttcgtagcaacatctacacatacatgccttcaaagatttgcgaagcaa
tctttggtgcccgtgatatgtatgacatctagaacacattctactatacaagcaatggct
actatcatgacgattattgaagaatttgggacaataagaaaattaaacatagcatatttt
ggttctccccatccagttcttaactcatatttgttgctatgtccaattcttggagccaat
atcaaatttaaatgttcctgttctaagcaaccagtaagccctctcctatacaaggcaggt
gagacactatgttcacagtcccacactagccttgaagcatgcacagacaaaaacaaagct
ctttgtaaggctgatgttatcatagccggtccagaaaatgccaaaaagttgagtgaattt
aagctatgttaccaggatatagaaaaactagcttgcccctcatggatatttcttcacact
tgtccaaggggcaaagaagtggatgacaacctttttttccatgatcgtgcaagaacattt
atagcttttgaaaattttcaatacattgctgcagcccttatggcatcaacaataaaagat
catacattttga

DBGET integrated database retrieval system