KEGG   Pandoraea pnomenusa: X636_04850Help
Entry
X636_04850        CDS       T02950                                 

Gene name
ompR
Definition
(GenBank) two-component system response regulator OmpR
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
prb  Pandoraea pnomenusa
Pathway
prb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:prb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    X636_04850 (ompR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:prb02022]
    X636_04850 (ompR)
Two-component system [BR:prb02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   X636_04850 (ompR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C FleQ OKR_DC_1_N HAD
Motif
Other DBs
NCBI-ProteinID: AHB74835
Position
4153661..4154407
Genome map
AA seq 248 aa AA seqDB search
MTTHPVRSNMKILVVDDDPDLRDLLREYLSRHGFSVAVMHDGDGLAARLERERPALIVLD
LMMPKVDGLTALRDLRARNDDVPVILLTARSDEIDRIVGLEIGADDYLGKPFSPRELLAR
INAVLRRRKTPDAAVPEQRENYTFGPFVLDFRSRTLTRDAQLLTLSDGEYGLLRLLVNHA
MQVLSRERIIELLYGAESDVNDRGIDVQIWRLRRLLDEDAQSPRFIQTVRGRGYIFVPDG
QRADMATG
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgacgacacaccctgtccgatcgaatatgaaaattcttgttgtcgacgacgatcccgac
ctgcgcgacctgctcagagagtatctgagccgtcacggcttctccgtcgcggtcatgcac
gacggggacgggctggccgcgcgcctggagcgtgagcgccccgccctgatcgtgctggac
ctgatgatgcccaaagtcgacggcctcacggccctgcgcgacctgcgcgcgcgcaacgac
gacgtgccggtgattctgctcaccgctcgcagcgacgagatcgatcgcatcgtcggactc
gagatcggcgccgacgactacctgggcaagccgttcagcccgcgcgagctcctcgcgcgt
atcaacgccgtgctgcgccgacgcaagacgcccgatgcggcggtaccggaacagcgcgag
aactacacgttcggtccgttcgtactcgacttccgcagccgcacgctcacccgcgacgcg
caattgctcacgctctcggatggcgagtacggcttgctgcgcctgctggtcaaccacgcc
atgcaggtgctctcgcgcgaacgcatcatcgaattgctctacggcgcggagagcgacgtc
aacgaccgcggcatcgacgtgcagatctggcgcctgcgccggctgctcgacgaggacgcg
cagagcccgcgcttcattcagaccgtgcgcgggcgcggctacattttcgtccccgacggc
cagcgcgccgacatggccaccggttaa

DBGET integrated database retrieval system