KEGG   Pandoraea pnomenusa: X636_19065Help
Entry
X636_19065        CDS       T02950                                 

Definition
(GenBank) diacylglycerol kinase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
prb  Pandoraea pnomenusa
Pathway
prb00670  One carbon pool by folate
prb00790  Folate biosynthesis
prb01100  Metabolic pathways
Module
prb_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:prb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    X636_19065
   00670 One carbon pool by folate
    X636_19065
Enzymes [BR:prb01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     X636_19065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: AHB77311
Position
complement(1839763..1840251)
Genome map
AA seq 162 aa AA seqDB search
MTILTLVVARAENGVIGRDNQLPWRLPEDLAHFKRTTLGKPIVMGRKTYDSIGRPLPGRR
NIVVSRNPALTIEGCDVVGSLIDAMRLCVGAEEICLIGGAQLYREALPSADKVVVTEIAR
AFEGDAHFPDLPATQWRETARETHHSPAPNDFDYAFVTYERI
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgacgatactgacgctggtcgtcgcccgcgccgagaacggcgtgatcgggcgcgacaat
caattgccgtggcgcctgcccgaggatcttgcccacttcaagcgcaccacgctcggcaag
ccgatcgtgatgggtcgcaagacctacgactcgatcggacgtccgctgcccggtcgccgc
aacatcgtggtctcgcgcaacccggcgctgacgatcgaaggttgcgacgtggtcggctcg
ctgatcgacgcgatgcgcctgtgcgtgggggccgaggaaatttgcctcatcggcggcgcg
cagttgtacagggaggccctgccgagtgccgacaaggtggtggtgacggaaatcgccagg
gccttcgagggtgacgcgcactttcccgacctgcctgcgacgcagtggcgcgaaacggcg
cgcgagacgcatcactcccctgcccccaacgacttcgattacgcgttcgtgacctacgag
cggatctga

DBGET integrated database retrieval system