KEGG   Pandoraea pnomenusa: X636_24315Help
Entry
X636_24315        CDS       T02950                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
prb  Pandoraea pnomenusa
Pathway
prb00071  Fatty acid degradation
prb00072  Synthesis and degradation of ketone bodies
prb00280  Valine, leucine and isoleucine degradation
prb00310  Lysine degradation
prb00362  Benzoate degradation
prb00380  Tryptophan metabolism
prb00620  Pyruvate metabolism
prb00630  Glyoxylate and dicarboxylate metabolism
prb00640  Propanoate metabolism
prb00650  Butanoate metabolism
prb00900  Terpenoid backbone biosynthesis
prb01100  Metabolic pathways
prb01110  Biosynthesis of secondary metabolites
prb01120  Microbial metabolism in diverse environments
prb01130  Biosynthesis of antibiotics
prb01200  Carbon metabolism
prb01212  Fatty acid metabolism
prb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:prb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    X636_24315
   00630 Glyoxylate and dicarboxylate metabolism
    X636_24315
   00640 Propanoate metabolism
    X636_24315
   00650 Butanoate metabolism
    X636_24315
  09103 Lipid metabolism
   00071 Fatty acid degradation
    X636_24315
   00072 Synthesis and degradation of ketone bodies
    X636_24315
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    X636_24315
   00310 Lysine degradation
    X636_24315
   00380 Tryptophan metabolism
    X636_24315
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    X636_24315
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    X636_24315
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    X636_24315
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:prb04147]
    X636_24315
Enzymes [BR:prb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     X636_24315
Exosome [BR:prb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   X636_24315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AHB78207
Position
2974059..2975381
Genome map
AA seq 440 aa AA seqDB search
MSAFKPTAPAPALRRVAILGGNRIPFARSNTAYATASNQDMLTAALQGLVDRFDLHGECL
GEVAAGAVLKHARDFNLTRESVLSTTLAPQTPAYDVQQACGTGLETAILTGNKIALGQID
VAIAGGVDTASDAPIGVNEHLRKILLEANRQRSTGGKLGALSKVRPGMLFRPALPRNGEP
RTGLSMGEHCELMAKQWQIDRAAQDELALASHRHLAAAYERGFFLDLMTPFRGLQRDNNL
RPDVSLETLAGLKPVFDRSAAGTLTAGNSTPLTDGASCVLLASEDWARAHNHPVLAYLTY
SRTAAVDYFNPDDAKREGLLMAPAYAVPRMLAQAGLTLQDFDFYEIHEAFAAQVLCTLKA
WEDPQYCRDRLGLAAPLGSIDRRRLNVNGSSLACGHPFAATGGRILATLAKRLAERGGGR
GLISICAAGGQGVVAMLERE
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcattcaaaccgaccgcaccggcgcctgccttacggcgcgtggcgattctcggc
ggcaaccgcattccgttcgcgcgctcgaacaccgcctacgccaccgcgtcgaatcaagac
atgctcacggccgcgttgcaaggcctcgtcgaccgcttcgacctgcatggggagtgcctc
ggggaagtggccgcgggcgccgtcctcaagcatgcgcgcgacttcaacctcacgcgcgaa
tcggtgctgtccacgacgctggcgccgcaaacccccgcttacgatgtccagcaggcctgc
ggcaccggcctggagacggccatcctcaccggcaacaagatcgcgctgggccagatcgac
gtcgctatcgcgggcggcgtggacaccgcgtcggacgccccgatcggcgtgaatgagcac
ctgcgcaagatcctgctcgaggccaatcgccaacgcagcacgggcggcaagctcggcgcg
ctgtccaaggtgcgcccgggcatgctgttccgcccggcgctgccgcgcaacggcgagccg
cgcaccggcctgtcgatgggcgagcattgcgagttgatggcaaaacagtggcaaatcgat
cgcgcggcgcaggacgaactcgcgctcgcgagccatcgacatttggccgcggcgtacgag
cgcggcttcttccttgacctcatgacgccgtttcgcggcttgcagcgcgacaacaacctg
cggcccgacgtctcgctcgagacactggccggcctcaaaccggtgttcgaccgcagcgcc
gccggcaccctcaccgcggggaattccacgccactgaccgacggcgcatcctgcgtgcta
ctcgcgagcgaggactgggcgcgcgcgcacaaccatccggtactcgcctatctgacctac
tcgcggacggccgccgtggactacttcaatcccgacgacgcgaagcgtgagggcctgctc
atggcgcccgcctatgccgtgccgcgcatgctcgcgcaggccggtctcacgttgcaggac
ttcgacttctatgaaatccacgaagcgttcgcggctcaggtgctgtgcacgctcaaggca
tgggaggacccgcagtactgccgcgaccggttggggcttgcggcgccgctgggcagcatc
gatcgccgtcgtttgaacgtgaacggcagttcgctggcctgcggtcacccattcgccgcc
accggcgggcgaattcttgccacgctcgccaaacggctcgccgagcgcggcggcggacgc
ggcctgatctcgatttgcgccgccggtggtcaaggcgtcgttgccatgctggagcgcgaa
tga

DBGET integrated database retrieval system