KEGG   Pseudomonas resinovorans: PCA10_01720
Entry
PCA10_01720       CDS       T02708                                 

Definition
(GenBank) hypothetical protein
  KO
K11910  type VI secretion system protein VasJ
Organism
pre  Pseudomonas resinovorans
Brite
KEGG Orthology (KO) [BR:pre00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pre02044]
    PCA10_01720
Secretion system [BR:pre02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PCA10_01720
SSDB
Motif
Pfam: T6SS_VasJ ImpA_N
Other DBs
NCBI-ProteinID: BAN45904
UniProt: S6BA09
Position
191645..193228
AA seq 527 aa
MSLSSLIASCLGQRDAQALARRQAPDWEAWLQPVDARSAVGEDPGYDDDFQHMREEVNKL
SGADAELVARLAEKLLKHRCKDLRVATYYLWARMQKDGEAGLADGLSLLAALVERFSADI
LPKRPNSRRMALEWLASAKVLDGLSLYPEVVKAEAERTVAALAWLEQGLGSWPEDQRPAL
GALYGALSSRLAQSGGVDALVPQNSASHETSRQGAAPVAAAIRSGRDLLDSGRALAGYLR
EQPLGWLAAHRLMKSLRWDSVHQTPPAEADGITRLTPPRSDYRAQLKRLFLQQSWSELLD
QVERIYAEGVNHFWLDLQWYLCQALAKQPAPQDGWADIAKRDLGMLLDRLPGLESLRWSD
GSPFADETTRDWIAQQVSGNRSPQWLPAPAMPVRGDDDILALEGEALAQADSDGVEAAIA
WLGDRPGLHSGRQRWLLRLLMARVAEQCGKTDLAIHLLTELESTAQRLALVEWESDLTFE
VQARLLKLLRLKAQRNDADKAALGRRQEALLASLVGIDPVRAAVLCG
NT seq 1584 nt   +upstreamnt  +downstreamnt
atgagcctgtcctcgctcatcgccagctgcctggggcagcgcgatgcccaggcgctggcc
cggcgccaggcgcccgactgggaagcctggctgcagccggtcgacgcccggtcggcggtc
ggcgaagaccccggctacgacgacgacttccagcacatgcgcgaggaggtcaacaagctc
tcgggcgccgatgccgagttggtggcgcggctggcggagaagctgctcaagcaccgctgc
aaggacctgcgggtagcgacctactacctctgggcgcgcatgcagaaggacggcgaggcc
ggcctggccgatggcttgagcctgctggccgcgctggtggagcggttctccgccgacatc
ctgccgaagcggcccaacagccgccgcatggccctggagtggctggccagcgccaaggtg
ctggacggcctgtcgctctacccggaggtggtgaaggccgaggctgagcgcaccgtggcg
gccctcgcctggctggaacagggcctgggatcctggccggaggaccagcggccggcattg
ggagcgctctacggtgccctgtcgagccgtcttgcgcagtccggcggggtcgacgcgctg
gtgccgcagaacagcgccagccacgagacgagtcggcagggcgccgctcccgtggccgcc
gccatcaggtctggccgtgacctgctggacagcggccgggccctggccggctacctgcgt
gaacaaccgctgggctggctggccgcgcaccggttgatgaagagcctgcgctgggacagc
gtgcaccagacaccgcccgccgaggccgacggcattacccggctcacgccaccgcgtagc
gactaccgggcccagctcaagcgcctgttcctgcagcagagctggagcgaactgctcgat
caggtcgagcgcatctatgccgaaggggtcaaccacttctggctcgacctgcagtggtac
ctgtgccaggcgctggccaaacagccggcgccgcaggatggctgggccgatatcgccaag
cgcgacctgggcatgctgctcgaccgtttgccgggcctggaatccctgcgctggagcgat
ggctcgccattcgccgacgagaccacccgcgactggatcgcccagcaggtgagcggcaat
cgctcgccgcaatggctgccggcgccggccatgccggtgcggggggatgacgacatcctc
gccctcgagggggaagcgctggcccaggccgacagcgatggcgtggaagcggctatcgcc
tggctgggcgaccggccaggcctgcacagcggccgccagcgctggctgctgcgcctcttg
atggcgcgcgtcgccgagcagtgcggcaagaccgatctggccatccacctgctgacggaa
ctggagtccacggcgcagcgcctggccctggtggagtgggagtcggatctgaccttcgag
gtgcaggcgcgcctgctcaagctgctgcgcctgaaggcccagcgcaacgatgcggacaag
gcggccctcgggcgccgccaggaagccctgctggcctcgctggtcggcatcgacccggtg
cgcgccgccgtgctctgcggctag

DBGET integrated database retrieval system