KEGG   Pseudomonas resinovorans: PCA10_05380Help
Entry
PCA10_05380       CDS       T02708                                 

Gene name
apaG
Definition
(GenBank) ApaG protein
  KO
K06195  ApaG protein
Organism
pre  Pseudomonas resinovorans
Brite
KEGG Orthology (KO) [BR:pre00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    PCA10_05380 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 CARDB Chitin_bind_4
Motif
Other DBs
NCBI-ProteinID: BAN46270
UniProt: S6AF33
Position
complement(597440..597820)
Genome map
AA seq 126 aa AA seqDB search
MSDTRYQVDVSVVTRFLPEQSQPDENRFAFAYTVTIQNNGELPAKLLTRHWVITDGDGHV
QEVRGAGVVGQQPLIAPGASHTYTSGTVMATQVGSMQGSYQMVADDGKRFDANIAPFRLA
VPGSLH
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgatacccgctaccaggtcgacgtcagcgtcgtcacccgcttccttccggagcaa
tcccagccggacgagaaccgctttgccttcgcctacaccgtgaccatccagaacaacggc
gaactaccggccaagctgctcacccgccactgggtgatcaccgacggcgacggccacgtg
caggaagtccgcggcgccggcgtagtcggccagcaaccgctgatcgcccccggcgccagc
cacacctacaccagcgggaccgtgatggcgacgcaggtcggcagcatgcagggcagctac
cagatggtcgccgacgatggcaaacgcttcgacgccaacatcgcccccttccgcctcgcc
gtacccggctcgctgcactga

DBGET integrated database retrieval system