KEGG   Pseudomonas resinovorans: PCA10_13460Help
Entry
PCA10_13460       CDS       T02708                                 

Definition
(GenBank) putative acetyl-CoA acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pre  Pseudomonas resinovorans
Pathway
pre00071  Fatty acid degradation
pre00072  Synthesis and degradation of ketone bodies
pre00280  Valine, leucine and isoleucine degradation
pre00310  Lysine degradation
pre00362  Benzoate degradation
pre00380  Tryptophan metabolism
pre00620  Pyruvate metabolism
pre00630  Glyoxylate and dicarboxylate metabolism
pre00640  Propanoate metabolism
pre00650  Butanoate metabolism
pre00900  Terpenoid backbone biosynthesis
pre01100  Metabolic pathways
pre01110  Biosynthesis of secondary metabolites
pre01120  Microbial metabolism in diverse environments
pre01130  Biosynthesis of antibiotics
pre01200  Carbon metabolism
pre01212  Fatty acid metabolism
pre02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PCA10_13460
   00630 Glyoxylate and dicarboxylate metabolism
    PCA10_13460
   00640 Propanoate metabolism
    PCA10_13460
   00650 Butanoate metabolism
    PCA10_13460
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PCA10_13460
   00072 Synthesis and degradation of ketone bodies
    PCA10_13460
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PCA10_13460
   00310 Lysine degradation
    PCA10_13460
   00380 Tryptophan metabolism
    PCA10_13460
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PCA10_13460
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PCA10_13460
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PCA10_13460
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pre04147]
    PCA10_13460
Enzymes [BR:pre01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PCA10_13460
Exosome [BR:pre04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PCA10_13460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: BAN47078
UniProt: S6ANC9
Position
1444235..1445383
Genome map
AA seq 382 aa AA seqDB search
MPQAYIVDALRTPTGRRKGGLSQIHAADLGAHVLRELVARNGIPEEDYDDVIFGCVDTIG
PLAGDIARTCWLAAGLHQAVPGTTIDRQCGSSQQAVHFAAQAVMSGTQDVVIAGGVQTMT
QIPISSAMTAAEPLGFSDPFSGSEGWVKRYGRVPPTQFRAAQMIAEKWQLSREALEAYAL
ESHRRALRAIEQGRFAREIVPLAGVEHDETPRQTSLDKMAELETLFGCDRVTAAVSSQTC
DGASALLVVSEAALKRYDLTPRARIQHISVRADDPVWMLTAPIPATEYALKRAGMKLEDI
DRVEINEAFASVAMAWLKETGYPHERTNVNGGAIALGHPLGATGTRLMCTLLHELERSGG
RFGLQTMCEGGGQANVTIIERL
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgccccaagcctacatagtcgacgccctgcgcacccccaccggccggcgcaagggcggc
ctgagccagatccacgccgccgacctcggcgcccacgtgctgcgcgaactggtagcgcgc
aacggtattcccgaggaggactacgacgacgtgatcttcggctgcgtcgacaccatcggc
ccgctggccggcgatatcgcccgcacctgctggctggccgccggcctgcaccaggccgtg
cccggcaccaccatcgaccgccagtgcggctcctcccagcaggcggtgcacttcgccgcc
caggccgtgatgagcggcacccaggacgtggtgatcgccggcggcgtgcagaccatgacg
cagatccccatctcctcggccatgaccgccgccgagcccctgggcttcagcgatcccttc
tccggctccgagggctgggtgaagcgctacggccgcgtgccgcccacccagttccgcgcc
gcgcagatgatcgccgaaaagtggcagctgtcccgcgaggcgctcgaagcctacgccctg
gaatcccaccgccgcgccttgcgggccatcgagcagggccgtttcgcccgggagatcgtg
ccgctcgccggcgtcgaacacgacgaaaccccgcgccagaccagcctggacaagatggcc
gaactggaaaccctgttcggctgcgaccgagtcaccgccgccgtgtcgagccagacctgc
gatggcgccagtgccctgctggtggtttccgaggcggcgctcaagcgctacgacctcacg
ccccgcgcgcgcatccagcacatcagcgtgcgcgccgacgacccggtgtggatgctcacc
gcgcccatcccggccaccgaatacgccctcaagcgcgccggcatgaagctcgaagacatc
gaccgggtggaaatcaacgaagccttcgcctccgtcgccatggcctggctgaaagagacc
ggctacccccatgaacgcaccaacgtcaacggcggcgccatcgccctcggccaccccctg
ggcgccaccggcacccgcctgatgtgcacgctgctccacgaactggaacgcagcggcggc
cgcttcggcctgcagaccatgtgcgaaggcggcgggcaggccaacgtaaccatcatcgag
cggctctga

DBGET integrated database retrieval system