KEGG   Pseudomonas resinovorans: PCA10_38470Help
Entry
PCA10_38470       CDS       T02708                                 

Gene name
hemN
Definition
(GenBank) oxygen-independent coproporphyrinogen III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
pre  Pseudomonas resinovorans
Pathway
pre00860  Porphyrin and chlorophyll metabolism
pre01100  Metabolic pathways
pre01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pre00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PCA10_38470 (hemN)
Enzymes [BR:pre01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     PCA10_38470 (hemN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C
Motif
Other DBs
NCBI-ProteinID: BAN49579
UniProt: S6BK48
Position
4221331..4222713
Genome map
AA seq 460 aa AA seqDB search
MLDNIRWDTDLIRRYDTPGPRYTSYPTAVQFNHKVASFDLLHALRDSRKACRPLSLYVHV
PFCANICYYCACNKVITKDRGRALPYLERLEREIELIACHLAPKQRVEQLHFGGGTPTFL
SHDELRRLMGHLRKHFHLLDDDSGDYGIEIDPREADWPTMGLLRELGFNRVSLGVQDLDP
AVQRAVNRLQSLDETRAIVEAARTLQYRSLNLDLIYGLPKQNPDGFARTLDEVIALQPDR
LSVFNYAHLPERFMPQRRIRNEDLPSPGQKLEMLQRSSEQLAAAGYRYIGMDHFALPHDE
LAIAQEDGRLQRNFQGYTTHGHCDLIGLGVSAISQVGDLYCQNTAQINDYQNALDAGLLA
TERGLLCDQDDRVRRAVIQQLICEFELDFDSIEGRFNIEFRGYFADIWPQLQQMHADRLI
DLSENRIDVLPAGRLLVRALCMLFDAYLPAQNQQRFSRVI
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacaacattcgctgggatacggacctgatccgccgctacgacacccccggcccc
cgctacacctcctaccccaccgccgtgcagttcaaccacaaggtggcgtccttcgacctg
ctccacgccctgcgcgacagccgcaaggcctgccgcccactgtcgctctacgtgcacgtg
ccgttctgcgcgaacatctgctactactgcgcctgcaacaaggtcatcaccaaggaccgt
ggccgcgccctgccctacctggagcgcctcgagcgggaaatcgaactgatcgcctgccac
ctagcccccaagcaacgggtcgagcaactgcactttggcggcggcaccccgaccttcctc
agccacgacgaactgcgccggctcatgggccacctgcgcaagcacttccatctgctggac
gacgattccggcgactacggcatcgagatcgacccccgggaggccgactggcccaccatg
ggcctgctgcgcgaactgggcttcaaccgcgtcagcctcggcgtgcaggacctggacccg
gcggtgcagcgcgcggtcaaccgcctgcagagcctcgacgagacccgcgccatagtcgaa
gccgcgcgtaccctgcagtaccgctcgctgaacctcgacctgatctacggtctgcccaag
cagaacccggacggcttcgcccgcaccctggacgaagtgatcgccctgcagccggaccgc
ctctcggtgttcaactacgcccacctgccggagcgcttcatgccccagcggcgcatccgc
aacgaagacctgcccagccccgggcaaaagctggagatgctccagcgcagcagtgaacag
ctggccgccgccggttaccgctacatcggcatggaccacttcgccctgccccacgacgag
ctggccatcgcccaggaggatggccgcctgcagcgcaacttccagggctacaccacccac
ggccactgcgacctgatcggcctcggggtatcggccatcagccaggtgggcgacctctac
tgccagaacaccgcgcagatcaacgactaccagaacgccctggacgcgggcctgctggcc
accgagcggggcttgctatgcgatcaggacgaccgcgtccggcgggcggtgatccagcaa
ctgatctgcgagttcgagctggacttcgacagcatcgaaggccgcttcaacatcgaattt
cgcggctacttcgccgacatctggccacaattgcagcaaatgcacgcggatcgcctgatc
gacctcagcgaaaaccggatcgacgtgctgccggccggccgcctgctggtgcgcgccctg
tgcatgctcttcgacgcctacctgccggcgcagaaccagcagcgcttctcccgggtgatc
tga

DBGET integrated database retrieval system