KEGG   Pseudomonas resinovorans: PCA10_39500Help
Entry
PCA10_39500       CDS       T02708                                 

Gene name
hldD
Definition
(GenBank) ADP-L-glycero-D-manno-heptose-6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
pre  Pseudomonas resinovorans
Pathway
pre00540  Lipopolysaccharide biosynthesis
pre01100  Metabolic pathways
Module
pre_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:pre00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    PCA10_39500 (hldD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:pre01005]
    PCA10_39500 (hldD)
Enzymes [BR:pre01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     PCA10_39500 (hldD)
Lipopolysaccharide biosynthesis proteins [BR:pre01005]
 Unusual sugar
  PCA10_39500 (hldD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd RmlD_sub_bind 3Beta_HSD Polysacc_synt_2 DapB_N
Motif
Other DBs
NCBI-ProteinID: BAN49682
UniProt: S6AGY5
Position
complement(4329199..4330227)
Genome map
AA seq 342 aa AA seqDB search
MSIIVTGAAGFIGSNLVQALNGRGETDIIAVDDLTEGDKFRNLADGEIADYLDKRDFLPL
LREGRFGRPRAVFHQGACSSTMEGDGRFMMDNNYRYSCELLEACLAQGVPFIYASSAAVY
GGNRVFREERAAERPLNVYGYSKFLFDQRVRRELPNARSQVVGLRYFNVYGPRESHKGRM
ASVAFHCFNQYRANGKVSLFGGYDGYAGGEHLRDFVSVEDVARVNLHFLDQPQRSGIFNL
GSGQAQPFNDVAWSMINALRSHDGLPPLSLAAMREQGLLAYSEFPDALRGKYQCFTQADI
SRLRQAGYRQPMLDVERGVTRYCHWLLEQESGGWLPELGKAA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcatcgttaccggtgccgccggcttcatcggcagcaacctggtccaggccctc
aatggccgcggcgagaccgacatcatcgccgtggacgatctgaccgaaggcgacaagttc
cgcaatctcgccgacggcgagatagccgactacctggacaagcgcgatttcctgcccttg
ctgcgcgaaggccgtttcggccggcctcgggcggtgttccaccagggcgcctgctccagc
accatggaaggcgacgggcgtttcatgatggacaacaactaccgctacagctgcgaactg
ctggaggcctgcctggcccagggcgtgcccttcatctacgcctcgtcggcggcggtgtac
ggcggcaaccgggtgttccgcgaggaacgcgcggccgaacggccgttgaatgtctatggc
tattccaagttcctcttcgaccagcgggtgcgtcgcgagctgcccaacgcccgcagccag
gtggtggggttgcgctacttcaacgtctacggcccccgcgagagccacaaggggcgcatg
gcttcggtggccttccactgcttcaaccagtaccgcgccaacggcaaggtgagcctgttc
ggcggctacgacggctacgccggtggcgagcacctgcgcgacttcgtgtcggtggaggac
gtggcgcgggtcaacctgcacttcctcgaccagccgcagcgctcgggcatcttcaacctc
ggcagcggccaggcccagcccttcaacgacgtggcctggagcatgatcaacgccctgcgc
agccacgacggcctgccgcccctgagcctggcggccatgcgcgagcaggggctgctggcg
tacagcgagttccccgatgccctgcgtggcaagtaccagtgcttcacccaggcggatatc
agccgcctgcgccaggccggctatcgccagccgatgctggatgtggagcggggggtgacg
cgctattgccactggctgctggagcaggagtcgggcggctggttgccggaattgggtaag
gcggcctga

DBGET integrated database retrieval system