KEGG   Pseudomonas resinovorans: PCA10_54120Help
Entry
PCA10_54120       CDS       T02708                                 

Gene name
pckA
Definition
(GenBank) phosphoenolpyruvate carboxykinase
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
pre  Pseudomonas resinovorans
Pathway
pre00010  Glycolysis / Gluconeogenesis
pre00020  Citrate cycle (TCA cycle)
pre00620  Pyruvate metabolism
pre01100  Metabolic pathways
pre01110  Biosynthesis of secondary metabolites
pre01120  Microbial metabolism in diverse environments
pre01130  Biosynthesis of antibiotics
pre01200  Carbon metabolism
Module
pre_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PCA10_54120 (pckA)
   00020 Citrate cycle (TCA cycle)
    PCA10_54120 (pckA)
   00620 Pyruvate metabolism
    PCA10_54120 (pckA)
Enzymes [BR:pre01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     PCA10_54120 (pckA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_16 AAA_25 AAA_29
Motif
Other DBs
NCBI-ProteinID: BAN51144
UniProt: S6BQ41
Position
complement(6025200..6026744)
Genome map
AA seq 514 aa AA seqDB search
MTQANNAVYTDISAAQLVEEAIRRGEGELAANGSLVVKTGHRTGRSPADRFIVQEPSTEA
KIAWGAINRPFPADKFDALWARVEAYVTERERFVSHVHVGSDPEHYLAVKMTTETAWHNL
FGRCLFINPEQYNPQSRQEWQIINAPNFVCEPERDGTNSDGCVILNFAAKKVLIAGMRYA
GEMKKAMFSVQNFLLPEKDVLPMHCAANVGEEGDTTLFFGLSGTGKTTLSADESRYLIGD
DEHGWGVGTVFNIEGGCYAKCIDLSAKNEPVIWKAIQFGAVLENVVLNPETRLPDYSDDS
LTQNSRAAYPLELVEKRVEANRAGEPNAVIFLTCDLTGVLPPVSILNNEQAAYHFLSGYT
ALVGSTEMGSGGGIKSTFSTCFGAPFFPRPAGEYAELLIKRIKGFGSKVYLVNTGWTGGG
YGVGKRFNIPTTRGVIAAIQSGALIGAETEHLPLINLDVPKAVPGVETNLLNPRNTWADK
AAYDEAAKGLAEKFIENFKKFDVSDAIKNAGPQL
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaagccaataacgccgtgtacaccgatatcagcgccgcgcaactggtcgaagag
gccattcgccgtggcgagggtgaactggccgccaacggttcgttggtagtgaaaaccggt
caccgcaccggtcgttctccggcggatcgattcatcgttcaagagccgagcaccgaagcc
aagatcgcctggggcgccatcaaccgtcccttcccggcggacaagttcgatgcactgtgg
gcccgcgtcgaagcttatgtgaccgaacgcgagcgtttcgtctcccatgtgcacgtaggt
tcggatcccgagcactacctggccgtgaagatgaccaccgaaaccgcctggcacaacctg
ttcggccgttgcctgttcatcaacccggaacagtacaacccgcagtcccgtcaggaatgg
cagatcatcaacgcaccgaacttcgtctgcgagccggagcgtgacggcaccaactccgac
ggttgcgtgatcctcaacttcgccgccaagaaagtgctgatcgccggcatgcgctacgcc
ggtgaaatgaagaaagccatgttctccgtgcagaacttcctgctgccggaaaaagacgtg
ctgccgatgcactgcgccgccaacgtgggcgaagaaggcgacaccaccctgttcttcggc
ctgtccggcaccggcaagaccaccctctccgccgacgaaagccgttacctgatcggtgac
gacgagcacggctggggcgtgggcaccgtgttcaacatcgaaggcggctgctacgccaag
tgcatcgacctgtccgccaagaacgagccggtgatctggaaagccatccagttcggcgcc
gttctggaaaacgtcgtgctcaacccggaaacccgcctgcccgactacagcgacgacagc
ctgacccagaactcccgcgcggcctacccgctggaactggtcgagaagcgcgtcgaagcc
aaccgtgccggcgagccgaacgcagtgatcttcctgacctgcgacctgaccggcgtgctg
ccgcccgtttcgatcctgaacaacgagcaggccgcctaccacttcctgtccggctacacc
gcgctggtcggttccaccgagatgggttccggcggcggcatcaagtcgaccttctccacc
tgcttcggcgcgccgttcttcccgcgtccggctggcgagtacgccgagctgctgatcaag
cgcatcaagggcttcggctccaaggtgtacctggtcaacaccggctggaccggcggtggc
tacggtgtcggcaagcgcttcaacatcccgaccacccgtggcgtgatcgcggcgatccag
agcggcgctctgatcggtgccgagaccgagcacctgccgctgatcaacctggacgtgccg
aaggccgttccgggcgtcgagaccaacctgctcaacccgcgcaacacctgggctgacaag
gctgcctacgacgaagccgccaagggcctggccgagaagttcatcgagaacttcaagaag
ttcgacgtctccgacgccatcaagaacgccggtccgcagctctaa

DBGET integrated database retrieval system