KEGG   Pseudomonas resinovorans: PCA10_p0300
Entry
PCA10_p0300       CDS       T02708                                 

Gene name
carBb
Definition
(GenBank) 2'-aminobiphenyl-2,3-diol 1,2-dioxygenase CarBb
  KO
K15755  2'-aminobiphenyl-2,3-diol 1,2-dioxygenase, large subunit [EC:1.13.11.-]
Organism
pre  Pseudomonas resinovorans
Pathway
pre00621  Dioxin degradation
pre01100  Metabolic pathways
pre01120  Microbial metabolism in diverse environments
pre01220  Degradation of aromatic compounds
Module
pre_M00544  Carbazole degradation, carbazole => 2-oxopent-4-enoate + anthranilate
Brite
KEGG Orthology (KO) [BR:pre00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    PCA10_p0300 (carBb)
Enzymes [BR:pre01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.-  
     PCA10_p0300 (carBb)
SSDB
Motif
Pfam: LigB
Other DBs
NCBI-ProteinID: BAN51414
UniProt: S6BQY3
Position
pCAR1.3:29971..30780
AA seq 269 aa
MGKIVAAGGTSHILMSPKGCEESAARVVNGIAELGRRLKEARPDVLVIITSDHMFNINLS
MQPRFVVGIADSYTPMGDMDIPRDLVPGSREVGRAIALQADEDGFDLCQAEEYSLDHGIM
IPILFMGMKEIPVVPVIVNINTDPIPSARRCVALAESIRQAIEKRTPDGCRVAVVGAGGL
SHWLCVPRHGEVSEKFDHMVMDELVRGNAEKLVAMGNEAIIDQGGNAGVEILTWIMAAVA
SEASSGEKVFYEAMTQWFTGIGGMEFHVK
NT seq 810 nt   +upstreamnt  +downstreamnt
atggggaagattgttgcggccggtggtacctcgcatattctcatgtctccaaaaggatgt
gaggagagcgctgctcgcgtggtgaacggcattgctgaactcggacggcgcttgaaggaa
gcacgtcctgatgtgctcgtcattatcacaagcgatcacatgttcaatatcaacttgtcc
atgcaaccgcgtttcgtggtgggcattgctgacagttatacgccgatgggtgacatggac
attccgcgtgatctggtgccgggaagccgcgaagttgggcgcgcgattgcgctacaggct
gatgaggacggctttgacttatgtcaagccgaggagtacagccttgatcacggcatcatg
ataccaatcctgttcatgggcatgaaagaaattcctgtagtgcctgtgattgtgaacatc
aatactgatcccatcccctcagcacgccgatgcgtggcccttgctgaaagcatccgtcaa
gcgatcgagaaacgtacgccagatggatgccgcgttgcggtagttggcgcaggcggtcta
tcgcactggctgtgcgttcctcgacatggagaggtaagcgagaaattcgaccatatggtg
atggacgagcttgtccgcggcaacgccgaaaagcttgtcgccatggggaacgaagccatc
atcgaccagggcggcaatgcgggcgtagaaatactgacgtggatcatggctgcggtagcg
tcagaggcatcgtcaggcgaaaaagtattttatgaagcaatgacacagtggtttaccgga
atcggaggaatggaatttcatgttaaataa

DBGET integrated database retrieval system