KEGG   Poecilia reticulata (guppy): 103457497Help
Entry
103457497         CDS       T05149                                 

Gene name
ppil6
Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase-like 6 isoform X1
  KO
K12739  peptidyl-prolyl cis-trans isomerase-like 6 [EC:5.2.1.8]
Organism
pret  Poecilia reticulata (guppy)
Brite
KEGG Orthology (KO) [BR:pret00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:pret03110]
    103457497 (ppil6)
Enzymes [BR:pret01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     103457497 (ppil6)
Chaperones and folding catalysts [BR:pret03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    103457497 (ppil6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-GeneID: 103457497
NCBI-ProteinID: XP_008395894
UniProt: A0A3P9NBL7
Position
LG21
AA seq 292 aa AA seqDB search
MASQTQIEIVGLLKDPNFHAARSIAEGLKQQFPDDLLDPVIVPLLEFDWHEYLCKKKREL
RGDVWEYPSNVICFLNGVLLGNEKQIASWAETQWNFTLTHPEDFYTAITEEYYAKHLQKS
GHKFVFMDVVIAGEDPGRICFELFSDVCPKTSENFEALCIGEQENERGYPLRYKGSLFHR
IVPNGWVQGGDIYLDSRGDGGESIYGPTFEDESFAISHSKRGILGMANKGPHTNGSQFYI
TLQPTPWMDKTYVAFGQVIEGVEVLKKLEESKTFNERPKYECRVSACGVLPM
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atggcctcacaaacgcaaatagaaatcgttggcctacttaaagacccaaatttccatgct
gccagaagtatagccgagggactcaaacaacagttccctgatgatcttttggatccagta
attgtgccacttcttgaatttgactggcatgaatacctatgcaagaagaaaagggagctg
cgtggtgatgtgtgggagtatcccagcaatgtgatatgcttccttaatggcgttctcctc
ggtaatgaaaagcaaatcgccagctgggcagagactcagtggaatttcaccctcactcat
ccagaggatttctatacggctatcaccgaggagtactacgccaaacaccttcagaaatct
ggacacaagtttgtcttcatggatgttgttatagcaggagaggatcctgggaggatatgt
tttgagctgttctccgatgtgtgtccaaagacttcagagaactttgaggctctgtgcata
ggagaacaagagaacgagcgtggctacccactccgctacaagggctctctgtttcatcgc
attgtgcccaacggctgggtgcaaggtggagatatttatcttgatagtagaggtgatggg
ggcgagtcaatctatggaccaacttttgaagatgaaagttttgctatttcccactcaaaa
cggggcattctgggaatggccaacaagggtccccacaccaatggatcccagttctacatc
accttgcagccgacgccctggatggacaaaacctatgttgcctttggtcaagtgattgaa
ggtgtagaagtcctgaagaaattagaagaaagtaagactttcaatgaaagacccaaatat
gaatgtagagtgtcagcttgtggagtgttaccaatgtag

DBGET integrated database retrieval system