KEGG   Poecilia reticulata (guppy): 103457596Help
Entry
103457596         CDS       T05149                                 

Definition
(RefSeq) dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial-like
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret00020  Citrate cycle (TCA cycle)
pret00310  Lysine degradation
pret00380  Tryptophan metabolism
pret01100  Metabolic pathways
pret01200  Carbon metabolism
Module
pret_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pret_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pret_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:pret00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    103457596
  09105 Amino acid metabolism
   00310 Lysine degradation
    103457596
   00380 Tryptophan metabolism
    103457596
Enzymes [BR:pret01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     103457596
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 DEC-1_N
Motif
Other DBs
NCBI-GeneID: 103457596
NCBI-ProteinID: XP_008396097
UniProt: A0A3P9Q450
Position
LG21
AA seq 436 aa AA seqDB search
MLSRSPCVYRTLSRSLSAASQVYNLGIQQSLSGHSICSQFVYRKSQLRRYLAPSNAFLCR
YFRTSAVCNDELVTVNTPPFAESVTEGDVRWEKAVGDSVADDEVVCEVETDKTSIQVPTP
AAGVIEELLIPDGGRVEAGTPLFRLRKGAAPAAKAAPSAATEDIPPPQPSTSAPLPPPPA
PSPPVSVAKPSPAPPAPPAAGVRGENRVRMSRMRLRIAERLKEAQNTCAMLSTFNEIDMS
NVNEMRKLYKEAFLTKHNVKLGFMSAFAKAASHALMDQPAVNAVIDEATKEIIYRDYVDI
SIAVATPKGLVVPVLRNVESMNYAEIEKTINALGEKARKNELAVEDMDGGTFTISNGGVF
GSLFGTPIINPPQSAILGMHGVFDRPVAINGQVEVRPMMHVALTYDHRLIDGREAVTFLR
KIKAVVEDPRLLLLDM
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgctgtcacggtccccgtgtgtttaccgcacgctgagtcggtccctgtcagcggcgagc
caggtttataatttgggtattcaacaaagtttatcgggtcactcaatctgcagccaattc
gtttacaggaaatctcagctgcgtagatatctggccccatcaaatgcattcctctgcagg
tactttaggacgtctgccgtttgcaacgacgaattggtcacagtcaacacgcctccattc
gccgagtcagtcacagagggcgatgtaaggtgggaaaaagcggtgggtgattcggtagca
gacgacgaagtggtgtgtgaagtcgagaccgacaagacgtcaattcaagtcccaactcct
gcagctggtgtgatcgaggagctgctgatccctgatggagggagggtggaagcaggaact
ccgctgttcagactacggaaaggagctgctccagctgccaaagctgctccttctgcagct
acagaggacatccctccacctcagccgtccacttctgctccactgccaccaccgcctgct
ccatccccgcctgtttctgttgccaaacccagtcctgcaccacccgctcctccagcagca
ggagtcagaggagaaaacagggtgaggatgagccgaatgaggctgaggattgctgagaga
ctgaaggaagctcagaacacctgcgccatgctgagcaccttcaacgaaatagacatgagt
aacgtcaatgaaatgaggaaactctacaaggaggcgttcctgacgaagcacaacgtcaaa
ctgggttttatgtctgcttttgctaaggcggcttcacatgctctgatggatcaacccgcc
gtcaacgctgttattgatgaagcgaccaaagagatcatctacagggactatgtggacatc
agcatcgctgtggcaactccaaagggacttgtagtgccggtgctacgaaatgtggagtcc
atgaactacgctgagatcgagaaaaccataaatgctctgggagaaaaggctcgtaaaaac
gagcttgcggttgaagatatggatggaggaacgttcaccatcagcaacggcggcgtgttt
ggctccttgttcggcacacccatcatcaacccccctcagtcggccatcctcggcatgcac
ggcgtcttcgacagacctgtggccatcaatggacaggtcgaggtccgacccatgatgcac
gtggcgctgacgtacgaccatcggctcatcgacggcagagaagcggtcaccttcttgcgc
aagatcaaagcggtggtagaagatcctcggctgctgctgctggacatgtga

DBGET integrated database retrieval system