KEGG   Poecilia reticulata (guppy): 103457712Help
Entry
103457712         CDS       T05149                                 

Definition
(RefSeq) leukotriene B4 receptor 1-like
  KO
K04296  leukotriene B4 receptor 1
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:pret00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103457712
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pret04030]
    103457712
G protein-coupled receptors [BR:pret04030]
 Rhodopsin family
  Lipid
   Leukotriene
    103457712
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1
Motif
Other DBs
NCBI-GeneID: 103457712
NCBI-ProteinID: XP_008396286
Position
LG21
AA seq 315 aa AA seqDB search
MDNNSNMNTSDFSLPPRTWVHNGLIPAVLLSFCFLLGVPGNIAVILLKPNWQNMSRLSQS
LMLNLAIFDLLSLLTLPLWIYALLSTWTFSLGTCKLLGFLVYCSLYGSLLTVTALGVQRY
IVVVNQRRCVQVQKSHLLVPLWFGATVLSIPALVTERVETNIYDGWRYCYPQFSSRAQGL
AVLLSETTSGFVSFFVVAYSYIRLHRKIRQATFFNNPQTTRLLTSIIVSNFVLWSPLHTI
NMLTLGAICFENDSLLKFCVDIWDIVKAIAFLNNCINPLLYAFSVQKMCRVCMNQELTKP
TQTLDISTVAETMIT
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggataataactccaacatgaacacctctgatttctctctacctcctcgcacctgggtg
cacaacggactgatccctgcggtactgctgtccttctgctttctcctgggagttcctgga
aacattgcagtgattcttttaaagcccaactggcagaacatgtcccgcctgagccagagt
ttgatgctcaacttggccatttttgacctgctctctctgctcactctcccactgtggatt
tatgctctgctcagcacctggacattcagtctcggaacctgtaagcttttaggttttctc
gtgtactgcagcctttacggcagcctgctgactgtgacagcgttgggtgtccagcggtac
attgtggtggtgaaccaacggagatgcgttcaggtacaaaaaagtcacctgctggttcca
ttatggtttggcgccacggtcctgtctatccctgctttggtgacggaacgggtggaaact
aacatctacgacgggtggaggtactgctaccctcagttttcatctcgagctcagggattg
gcagtgctgctgtcagagaccacatctggctttgtttccttttttgtcgtggcctattcc
tacattcgccttcacaggaagattagacaggcaaccttcttcaacaacccacagacgacc
aggctgctgaccagcatcattgtaagcaattttgttctgtggtctcctcttcataccata
aatatgttgaccctgggagccatctgcttcgaaaatgacagcttgttgaagttttgtgta
gacatatgggacattgtcaaagcaattgcttttctaaataattgcattaacccactgctg
tatgcctttagcgtccaaaaaatgtgcagagtctgcatgaaccaagaattgacaaagcct
acacaaacactagatataagtacagttgcagaaactatgattacctag

DBGET integrated database retrieval system