KEGG   Poecilia reticulata (guppy): 103457913Help
Entry
103457913         CDS       T05149                                 

Gene name
mgat2
Definition
(RefSeq) alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
  KO
K00736  alpha-1,6-mannosyl-glycoprotein beta-1,2-N-acetylglucosaminyltransferase [EC:2.4.1.143]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret00510  N-Glycan biosynthesis
pret00513  Various types of N-glycan biosynthesis
pret01100  Metabolic pathways
Module
pret_M00075  N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:pret00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    103457913 (mgat2)
   00513 Various types of N-glycan biosynthesis
    103457913 (mgat2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pret01003]
    103457913 (mgat2)
Enzymes [BR:pret01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.143  alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
     103457913 (mgat2)
Glycosyltransferases [BR:pret01003]
 Glycan extension
  N-Glycan
   103457913 (mgat2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MGAT2
Motif
Other DBs
NCBI-GeneID: 103457913
NCBI-ProteinID: XP_008396613
Position
LG21
AA seq 471 aa AA seqDB search
MRFRIYKRKVVILTLVVVICGLAFWSSGRQKKNITLQFSKEFPKEFEAVKRSSSLSSSSG
SLNNHIQLQATPAVSRAPVPPPVIQANGTHLDDAKDKAKMNKPEVDNATLVYRGIVFQLN
FDQTIRNEEKYKTRQKDDLVVVVQVHNRPDYLKLLVDSLRKARGVESILLIFSHDYWSPE
INKVVASVDFCQVLQIFFPFSIQLYPQEFPGNDPRDCPRDIPKKDALKLGCINAEYPDSF
GHYREAKFSQTKHHWWWKLHFVWDRVRALKDHQGLVLLIEEDHYLSPDFIHLLKLMKALR
REQCTDCDILSLGSYSHIGYSSKANKVEVKAWKSTEHNMGMALSRETYHKLIRCTDTFCT
YDDYNWDWSLQHLTVACLPSYWKVMVSEAPRVFHAGDCGMHHKKASCMPISQKTKIENIL
QSSGNQLFPKNLLITKRLPANGAGGVAPHVKNGGWGDIRDHELCKSYVRLQ
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgagattccgaatctacaagaggaaggtggtgatactgactctggtggttgttatctgt
ggcctagctttttggagcagcggaaggcaaaaaaagaacataactcttcaattctccaag
gagttccccaaggaatttgaggctgtgaaaaggagcagcagcctcagcagcagcagtggc
agcctcaacaatcacatccagttgcaagccactcctgcagttagccgtgcacctgtcccg
ccacccgttatccaagctaacggcacgcacctggacgatgcaaaggataaagccaaaatg
aacaagccagaggtggacaacgccactctcgtctatcgcggcatcgtcttccagctgaat
ttcgaccagacgataagaaacgaagagaagtacaagactcggcagaaagatgatctggtc
gtggtggttcaggtccacaaccgacccgactacctgaagctgctggtggatagcctgcga
aaggccaggggagtggagagcatattgctgatattcagccatgactactggtctcctgag
ataaacaaagtggtggcctcggttgacttctgtcaagtccttcagattttcttccccttc
agcattcagctctacccccaagaattcccggggaacgaccccagggactgcccaagagat
attcccaaaaaagacgccttaaaactcggatgcatcaacgcggagtacccggactccttc
ggccactaccgtgaggcaaagttctcccagaccaagcaccactggtggtggaagctgcac
ttcgtctgggacagagtgagagctctcaaagaccaccaaggactggttctgctcatagag
gaagaccactatctgtcgccagactttatccaccttttaaagctgatgaaagctctcaga
cgggagcagtgcactgactgcgacatcctgtccctcgggagctacagccacatcggctac
tccagcaaagcgaacaaggtggaggtgaaggcctggaagtcgacggagcacaacatggga
atggctctgagcagagagacgtaccacaagctcatccggtgcaccgacacgttctgcact
tacgacgactacaactgggactggtccctgcagcacctgaccgtggcctgcttgccctcc
tactggaaggtcatggtgagcgaggcgcccagggtctttcacgccggggactgcggcatg
caccacaagaaggcctcctgcatgcccatcagtcagaagacaaagatcgagaacatactt
cagagcagcggaaaccagctgttccccaaaaacctcctgatcacaaagagactgccagcc
aacggcgccggaggagtggccccgcatgtgaaaaatgggggctggggagacatcagggat
cacgaactctgcaagagttacgttcgattacagtga

DBGET integrated database retrieval system