KEGG   Poecilia reticulata (guppy): 103461600Help
Entry
103461600         CDS       T05149                                 

Definition
(RefSeq) probable low-specificity L-threonine aldolase 2
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret00260  Glycine, serine and threonine metabolism
pret01100  Metabolic pathways
pret01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pret00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    103461600
Enzymes [BR:pret01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     103461600
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 103461600
NCBI-ProteinID: XP_008402086
Position
Unknown
AA seq 109 aa AA seqDB search
MDGARVMNAAVALGVPPSSILQHTHTVSVCLSKGLGSPVGTMLAGPRDFISRAVRCRKAV
GGGMRQTGVLAAAGKLSLLEMVGRLEDDHHNAKTFALGEWLTIPYLRKR
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atggatggagcgagggtgatgaacgccgccgtggccctcggcgtgcctccgtcctccata
ctgcagcacacacacacagtcagcgtctgcctctccaagggtttgggctcgccggtgggc
accatgctggccggacctcgggacttcatatccagagcagtgcgctgccgtaaagccgta
ggcggggggatgcgacagactggtgtccttgcagcagcyggaaagctgtctttgttggag
atggtaggacggcttgaggatgatcaccacaatgcyaaaacctttgctctgggtgagtgg
ctcaccatcccgtatttaagaaaaagataa

DBGET integrated database retrieval system