KEGG   Poecilia reticulata (guppy): 103463223Help
Entry
103463223         CDS       T05149                                 

Gene name
dock7
Definition
(RefSeq) dedicator of cytokinesis protein 7
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
pret  Poecilia reticulata (guppy)
Brite
KEGG Orthology (KO) [BR:pret00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pret04131]
    103463223 (dock7)
Membrane trafficking [BR:pret04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    103463223 (dock7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 DOCK_N
Motif
Other DBs
NCBI-GeneID: 103463223
NCBI-ProteinID: XP_008404683
Position
LG4
AA seq 2149 aa AA seqDB search
MAERRAFAQKISRTVAAEVRKQIAGQYGGSPQLFKNLNVGTTSSNTVPLTEAVEPVDFEE
YLITHPPIVESGPLRDLIEFPPDDIEVTYTPRECRTVVPAVPEEGDTDTHVRDCVRSYTE
DWAIVNRKYHKLGTGFNPNTLDKQKERQKGLPKQVFEADEMPDSSSYQDDQDDLKRRSMS
IDDTPRGSWACSIFDLKNSLPDALLPHLLDRAPNEEIDRHNEDQRKASRHRELFALHPAL
DEEEPIERHCVPEVPKEHFGQRLLVKCLSLKFEIEIEPIFASLALYDVKEKRKISENFFF
DLNSEQMKGMLRPHIQTAAISTLARSAIFSITYPSQDIFLVIKLEKVLQQGDIGECAEPY
MVFKESDAAKNKEKLEKLRSQSEQFCQRLGRYRMPFAWTAIHLMNIVNSAGSLERDTELE
MSLSERKGSWSERRNSSIMGRRSLERTTSGDESCSLTGFRPATLTITNFFKQEGDRLSDE
DLFKFLADMRRPSSVLRRLRPITAQLKLDISPAPENPHYCLTPDLTQVKPYPDSRVRPTR
EILEFPARDVYVPNTTYRNLLYVNPQSLNFANRQGSARNITVKVQFMNGEDPSNAMPVIF
GKSSCADFYKEAYTAVVYHNRSPDFHDEVKIKLPASLSDHHHILFTFYHVSCQQKQNTPL
ETPVGYTWIPMLQNGRLRTGHFCLPVSLEKPPQSYSVLSPDVPLPGMKWVDNHRGVFNVE
LAAVSTIHTQDQYLDKFFALVHALDEHVFPVRIGDMRIMENNLETELKSSIAALNSAQLE
PVVRFLHLLLDKLVLLVVRPPVIAGQIVNLGQASFEVMASVVNRLHKYLDTSQDMHGRNS
LLSSYIHYVFRLPSTDPNSPSPDNNSSLTGPGGLGGSVHYATMARSAVRPASLNLSRSRS
LSNSNPDISGTPTSPDDEVRSIIGSKGLDRSNSWVHTMGCSAPWGSSPGSAPETMQAMER
CGNRMSSHTESASFLQTLTGRLPTKKLFHEELALQWVVSSGSVREGALQQAWFFFELMVK
SIIHHLYFTERLESPRKNRFPERFMDDITALVSTIAGDIVSRFQKDLELVERINTSLAFF
LNDLLSVMDRGFVFTLIKTYWKQVSTKLYALQNPTLESLRLDFLRIVCSHEHYVTLNLPC
SLLTPPASPSPSVSSATSQSSGFSTHVQDQKIANMFELSIPFREQHYLAGLVLSELSVIL
DPDNEGMFGLHKKVVSVVHNLLSSHDSDPRYADTEVKARVAMLYLPLIGIVMETLPQLHD
FTESHNQWGRPGCPQGTAVGSGGEEAEGEGNSMISQTVAMAIAGTSTASPMSRPSSFLLN
SQTGRQHGSFSAESSRSLLICLLWVLKNADELVLQKWFTDLSVSQLNRLLDLLYLCVSCF
EYKAHVVFTMQGKKAFERMNSLTFKKSKDMKAKLEEAILGSIGARQEMVRRSRGQLERSP
SGSAFGSQENLRWRKDMTHWRQNSERMDKSHRSVRTRAELEHEALIDGNLATEANLIILD
TLEIVVQTASVTESKESILGGVLKVLLHSMACNQSALYLQHCFATQRALVSKFPELLFEE
ETEQCADLCLRLLRSCSSSISTIRSHASASLYLLMRQNFEIGNNFARVKMQVTMSLSSLV
GTSQNFNEEFLRRSLKTILTYAEEDLELRETTFPDQVQDLVFNLHMILSDTVKMKEXQED
PEMLVDLMYRIAKGYQTSPDLRLTWLQNMAGKHSERSNHAEAAQCLVHSAALVAEYLSML
EDRKYLPVGCVTFQNISSNVLEESAVSDDVVSPDEEGICSGKYFTEIGLVGLLEQAAASF
SMAGMYEAVNEVYKVLIPIHEANRDAKKLATIHGKLQEAFSKIVHQSTGWEDGKRMFGTY
FRVGFYGSKFGDLDEQEFVYKEPAITKLAEISHRLESFYGERFGEEQVEVIKDSNPVDKC
KLDPNKAFIQITYVEPYFDTYEMKDRITYFDKNYNLRRFVYCTPFTLDGRAHGDLHEQFK
RKTILTTSHAFPYIKTRINIIHKEEIISTPIEVAIEDMQKKTQELAFATHQDPADAKMLQ
MVLQGSVGTTVNQGPLEVAQVFLSEIPSDPKLYRHHNKLRLCFKDFTKRCEDALRKNKSL
IGPDQKEYQRELERNYHRLKEALQPLINRKIPQLYKPVLQVNSRSKRTA
NT seq 6450 nt NT seq  +upstreamnt  +downstreamnt
atggctgaacgccgcgcattcgcccaaaaaatcagcaggactgtggcagcagaggtcagg
aagcagatagctggtcagtatggcggctcccctcagctcttcaaaaacctcaatgttgga
acaacatctagcaacacagttccactcacagaggcagtggaaccagtggactttgaggag
tatctcatcacacacccccccattgttgagtccggtcccctcagagatctgatcgagttt
ccccctgatgacatcgaggtcacctacacacccagggaatgtcgcaccgttgtaccagct
gtccctgaagaaggggacactgacactcatgtcagagattgtgtcagatcatacacagag
gactgggccattgttaacagaaaatatcataaacttgggacgggttttaaccccaacact
ctggacaagcagaaagagcgtcagaaaggtttacctaagcaagtgtttgaggccgatgag
atgccagacagcagcagctatcaggacgaccaggatgatctgaagaggcgatcgatgtct
atagatgacactccgcgtggcagctgggcctgcagcatctttgacttgaagaattccctt
ccagacgctcttctccctcacctcctcgaccgtgctcccaacgaggagattgatcggcac
aatgaagaccagcgcaaggccagccgccatcgcgaactctttgctttacatcccgctctc
gatgaggaggagcccattgagcgccactgtgtgcctgaagtacctaaagagcactttggc
caaaggctactcgtcaaatgcttgtccttgaagtttgagatcgaaattgaacccatattt
gctagtttggccttatacgatgtcaaggaaaagagaaagatatccgaaaactttttcttc
gacttaaattcggagcagatgaaaggaatgttgcgtccgcacatccagacggcagccatc
tccaccctggcgcgctctgccattttctccatcacctatccttcccaggatatcttcctg
gtcatcaagctagaaaaggtactacagcaaggtgatattggtgaatgtgcagagccttac
atggtcttcaaggagtcagatgcagccaagaacaaagagaagctggagaagctccgaagt
cagtcagagcaattctgtcagcgtctgggtcgctacaggatgcctttcgcatggaccgcc
atccacctgatgaacattgtcaacagcgctggcagcctggagagagataccgaattagag
atgagcttatcagagagaaaaggctcatggtcagaacggaggaactcgagcatcatggga
aggcgttccctggagaggaccaccagtggagatgaatcatgcagtctgacaggatttagg
cctgcaacacttaccattacaaacttctttaaacaggaaggggacaggctcagtgatgaa
gatttgtttaagtttctggctgacatgaggagaccttcttcagtcctgagaaggctcagg
cccataacagcccagttaaagttagacatctccccagctccagagaacccccactattgc
ctgactcctgaccttacccaggttaaaccttacccagacagcagggtgcgccccaccaga
gagatcctggaatttcctgccagggacgtctatgtgccaaacaccacgtacaggaatttg
ctgtatgtcaaccctcagagtcttaactttgccaaccggcagggctctgctcgcaacatc
acagtcaaagtgcaatttatgaatggagaggatccaagcaatgcaatgccggtcatattt
gggaagtcaagttgtgcagatttttataaagaggcctacactgcagttgtttatcacaac
agatcccctgacttccatgatgaggtgaagatcaagttgcctgcctccctgtcagaccac
caccacattctcttcacgttttaccacgtcagctgccagcagaagcagaacacgccactg
gagacccctgtggggtacacgtggatcccaatgttacagaatggccgtctgaggacagga
cacttctgcctgcctgtatctcttgagaagccaccacagtcctactctgttctctctcca
gatgttcccctcccaggaatgaagtgggtagacaaccatcgaggagtctttaatgtggaa
ctggcggctgtttcaactatccacacacaggaccagtacctggataagttttttgccttg
gtgcatgccctggatgagcatgtgtttccggtcaggattggagatatgcgcatcatggaa
aacaaccttgagaccgagctgaagtccagcatcgcagcactcaactccgctcagctggag
ccggtggttcgattccttcaccttcttcttgacaaattggtgctgctcgtagttcggccg
ccagtcatcgctggacagatcgtgaatctaggtcaagcatccttcgaggtaatggcgtct
gtagtgaaccgacttcacaagtacctggacaccagccaggacatgcatggccgcaacagc
ctgctgtcctcttacatccactacgtcttccgcttacccagcacagatcccaactcgcca
tcaccagacaacaactcatctttaacaggtcctggagggttgggtggttcggttcactac
gccaccatggctcgctcagctgttcgaccagccagcctcaacctcagtcgctcccgtagc
ctgagcaacagtaaccctgacatatctggtacgcccacctctcccgacgatgaagttcgc
tccataattggaagcaagggcttagaccgctccaactcgtgggtgcacaccatgggctgt
agtgccccctggggatccagccctgggtccgctccagaaaccatgcaggccatggagcgc
tgtggcaatcgcatgtcttcgcacactgagagcgccagtttcttgcaaactttaacagga
cgattacccactaaaaagctctttcacgaggagttggccctgcagtgggtggtgagcagt
ggaagtgttcgggagggcgctctgcaacaggcctggtttttctttgaactgatggtaaag
agcattatccaccacctttactttaccgagcgcttggagtcgccaaggaaaaaccgattt
cctgagcgctttatggatgacatcacagcgctggtcagcaccattgctggagacatcgtc
tctcgtttccagaaggatctggagttggtggagaggataaacactagcctggccttcttc
ctcaatgatttgttgtcagtcatggaccgaggctttgtcttcacattaatcaagacatat
tggaaacaggtgtcgacaaagctctatgctttgcagaacccaactctggaatctttacgg
ctggattttctaagaatcgtttgtagtcatgaacactacgtcaccctgaatctgccctgc
agtctgctaaccccacctgcctcgccttcaccatcagtgtcctcggcaacctcacagagc
tctgggttttccactcacgtccaagaccaaaagatagccaacatgtttgagctttctatc
ccattcagagagcaacattatctggctgggctcgtgctctctgagctttctgttatactg
gacccagacaatgagggaatgtttggcctgcataagaaagtggtgagcgttgttcacaac
ctcctgtcaagccatgactctgaccctcgatatgctgacacagaggtcaaggctcgggtc
gctatgctctacctgcctcttatcggaatcgttatggaaacgctgccgcagctccatgat
tttacagagtcgcacaatcagtggggtcggcccggttgtccccaaggtacggctgtgggt
agcgggggagaagaagcagaaggagagggcaacagtatgatcagtcagactgttgccatg
gcaatagccggcacctccaccgcatctccaatgtcccgaccaagtagctttttgctgaac
tcgcagacgggtcgccagcatgggagcttctcggccgagtcgagccgcagtctgctgatc
tgtctgctctgggttttgaagaacgccgacgagctggtgctgcagaaatggtttacagac
ctgtctgtgtctcagctcaaccgcctgctggatctcctctacctctgcgtgtcttgcttt
gagtacaaggcccatgttgtgttcaccatgcagggaaagaaggccttcgagcgcatgaac
agcttaacgtttaagaagtccaaagacatgaaggccaagctggaggaggccatactgggc
agcatcggcgccaggcaggaaatggtgcgccgcagcaggggacagctagagcggagtcca
tctggcagtgcttttggcagtcaagaaaacctccggtggaggaaggacatgacccactgg
agacaaaacagtgaaaggatggacaagagtcacagatcagtcaggacgcgagcggagttg
gaacatgaagcacttatagatgggaacctagcaacagaggccaacttaattattcttgat
actttggagattgttgtacagacggcatcagtgactgagtctaaggagagcattctgggt
ggrgtgttaaaggtgctgcttcacagcatggcctgcaaccagagcgccctctaccttcag
cactgttttgccacacaaagagctctggtttccaagtttccagagctgctgtttgaggag
gaaacagagcagtgtgcggatctgtgtttgcgactcctgagaagctgcagcagtagcatc
agcaccatcaggtcccacgccagcgcttccctctacctcctcatgaggcaaaactttgag
attggtaacaactttgccagagtgaaaatgcaggtgaccatgtctctgtcctcgctggtc
ggaacgtcccagaattttaatgaagagtttctccgtcgctcgttgaaaactatcctcacc
tatgcagaggaagacctggaactcagagagaccacctttccagatcaggtccaggacctt
gtgtttaatctgcacatgatcctgtctgacacggtgaagatgaaggaacawcaagaagat
cctgagatgttggttgatctcatgtacaggattgcgaagggataccagacatccccggac
ctgcgtctgacgtggctgcagaacatggcgggaaaacactcggaaaggagcaatcacgcc
gaggcggcgcagtgtttggtgcacagcgctgccctggtagcagaatacctgagcatgctg
gaggaccgcaagtaccttcctgtaggctgcgtcacctttcagaacatctcttcaaatgtg
ctggaggagtcggctgtctctgacgatgtcgtgtcaccagatgaagagggtatctgctct
gggaaatattttactgaaatcggtcttgtgggcctcctggagcaggccgctgcctccttc
tccatggctgggatgtatgaggcagtgaatgaagtatacaaggtgctaatcccaatccac
gaagccaacagagatgcaaagaagctagccaccatccatggtaaactgcaggaagccttt
agcaaaattgtccatcagagtactggctgggaggacgggaagaggatgtttggtacgtac
ttcagggtgggattttatggttcaaagtttggcgacttggatgagcaggagtttgtgtac
aaagagccggccatcacgaagctggccgaaatctcccacaggctcgagagcttctatggg
gagcgcttcggggaggagcaggtagaagtcattaaggactccaaccctgtagataagtgc
aaacttgaccccaataaggccttcatccagatcacgtacgtggagccgtacttcgacact
tacgagatgaaagaccgcataacctacttcgacaagaactacaacctgaggcgctttgtg
tactgcacccctttcaccttggacggccgggcccacggggacctgcacgagcaattcaaa
cgcaagaccatccttaccacgtcacacgcctttccttacatcaagacgaggatcaacatc
attcacaaggaagagattatttccacacccatagaggtggcgatagaggatatgcagaag
aagacgcaggagctggcctttgccacccaccaggaccctgctgacgccaaaatgctgcag
atggtcctgcagggatctgtgggcacaacggtgaaccagggtccgttggaagtggctcag
gtgttcctgtcagaaatcccaagtgacccaaaactgtatcgacaccacaacaagctccgc
ctgtgctttaaggacttcacaaagaggtgcgaagacgccctccggaagaacaagagcctg
atcggaccggaccagaaagagtaccagagggagctggagcggaactaccacagactgaag
gaggcgctgcagcccctcatcaacaggaagatcccgcagctttacaaacccgtcctgcag
gtcaactcacgcagcaaacggacagcttga

DBGET integrated database retrieval system