KEGG   Poecilia reticulata (guppy): 103464005Help
Entry
103464005         CDS       T05149                                 

Gene name
cpt2
Definition
(RefSeq) carnitine O-palmitoyltransferase 2, mitochondrial
  KO
K08766  carnitine O-palmitoyltransferase 2 [EC:2.3.1.21]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret00071  Fatty acid degradation
pret01212  Fatty acid metabolism
pret03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:pret00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    103464005 (cpt2)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    103464005 (cpt2)
Enzymes [BR:pret01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     103464005 (cpt2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf
Motif
Other DBs
NCBI-GeneID: 103464005
NCBI-ProteinID: XP_008406021
UniProt: A0A3P9PE12
Position
LG4
AA seq 667 aa AA seqDB search
MATLLSAQCAVCLRKPGTRLHLRRAAARISARCYSSRTASTADYLHESVVPSMHYQKSLP
RLPVPKLEDTIRRYLAAQKPLLDDGQFATTEKIAQDFQNGVGRQLHEELVAQDKANKHTS
YISGPWFDMYLSARDSVVLNFNPFMSFNPDPKTEYNEQLVRSTNMVCSAVRFMKTLRAGL
LEPEVFHLNPAKSDTDSFKNFIRWVPSSLSWYGAYMVNAYPLDMSQYFRLFNSTRIPKRG
RDELLTDDKGRHLLIMRKGNMYVFDVVDRDGNLVKPAEIHSHLKYILSDSTPAPSLPLGI
LTSENRDVWAGLREKLKVTGNAEALGLVDSALFCLCLDEESMRDHIHISHNMLHGDGCNR
WYDKSFSIIIAKDGQTAINFEHSWGDGVAVLRFQNEVFKDTTEKPVVHPGSAPAAVDSAS
AVRRLQFHLDGELESGIKKAKENFDLAVSKLTIAAIEFKKGGKEQLKKSKLSPDAIAQLS
FQMAFLRQYGQTAATYESCSTAAFKHGRTETIRPATVHTKRCSHAFVREPSKHSVEELQA
MLNECSKYQGQLTKEAAMGQGFDRHLFALRYLANSKGRSLPSLYTDPAYGAINHNILSTS
TLTSPAVSLGGFAPVVPDGFGVGYGVHDNWIGCNVSAYPARNVHEFLQCVHKSLEDIFSV
VEGKPLS
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atggccaccttgctgtcagcacaatgcgctgtctgcctgaggaaacccgggactcggctt
catttaagaagagccgcagcgaggatctcagctcggtgctacagcagcaggactgcttct
actgcggactatctgcacgaaagcgtcgttccttccatgcattaccagaagagtttaccc
agactccccgttcccaagctggaggacaccatcaggaggtatttagctgcccagaaacct
ttgctggatgatggccagttcgcaacaacggagaaaattgctcaagatttccagaacgga
gtgggaagacagctccacgaggaactggtggctcaagacaaggccaataagcacacaagc
tacatctcaggtccctggttcgacatgtatctgtctgctcgtgactctgtggtgctgaac
ttcaaccccttcatgtccttcaatcccgatccaaagacggagtacaacgagcagctggtg
cggtcaactaacatggtgtgctcggccgtgcgctttatgaagacgctgcgagcgggtcta
ctggagccggaggttttccacctcaacccggccaagagtgacacggacagcttcaaaaac
ttcatccgctgggttccgtcttcactgtcctggtacggagcctacatggtgaacgcctac
cctctagacatgtctcagtacttccgcctcttcaactcaacgcgcatcccaaaacgcggt
cgagatgagctcctcaccgacgacaagggcagacatctgctaatcatgcgaaaaggcaac
atgtatgtattcgacgttgtggacagagacgggaatttggtgaagccggcagagatccat
tcccacttgaagtatattttgtctgactcgacaccggcgccctccttgcctctgggcatc
ctgaccagtgagaacagagatgtctgggcggggctaagagagaagctgaaagttactgga
aacgcagaggcgttggggctagtcgacagcgcccttttctgtctctgtctggatgaagag
agcatgcgggaccacattcacatatcccacaacatgctgcatggcgacggctgcaaccgc
tggtatgacaagtccttcagcatcatcatagccaaggacggtcagacagcaattaacttc
gagcactcttggggtgacggagtagccgttctccgctttcagaacgaggtgttcaaagac
acgacagagaagccggtggtgcacccaggctctgccccggcggccgtggactcagcctcc
gctgtccgcagattgcagttccacttggacggagagctggagagcggtatcaagaaagcc
aaagagaactttgacttggctgtatcgaagcttaccattgccgccattgagttcaagaaa
ggcgggaaggagcagctgaagaagagcaagctgagtccagacgccatagcccagctgtct
tttcagatggccttcctgaggcagtacggccagacggcggccacatatgagtcctgcagc
actgcagcatttaagcatggccgcacagagaccatccgaccggccaccgtccacaccaaa
cgctgctcacacgcctttgtccgtgagcccagcaagcacagcgtggaggagctgcaggcg
atgctcaacgaatgctccaaataccaaggccagctcaccaaggaggcagctatgggtcaa
gggtttgaccgccacctgtttgctctgcgttaccttgccaactctaagggtcgatctctg
cccagcctgtacacggacccagcctacggcgccataaaccacaacatcctgtccaccagc
acactgaccagccccgccgtcagcctcgggggcttcgctccggtggtgcccgacgggttc
ggtgtcggttacggtgtccacgacaactggatcggctgcaacgtgtccgcctatcctgct
cgcaacgtccatgagtttctgcagtgtgtccacaagtctttggaggacatcttcagtgtt
gtggaagggaaacctttgagttga

DBGET integrated database retrieval system