KEGG   Poecilia reticulata (guppy): 103464554Help
Entry
103464554         CDS       T05149                                 

Definition
(RefSeq) isotocin receptor-like
  KO
K04229  oxytocin receptor
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04020  Calcium signaling pathway
pret04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:pret00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    103464554
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103464554
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pret04030]
    103464554
G protein-coupled receptors [BR:pret04030]
 Rhodopsin family
  Peptide
   Oxytocin
    103464554
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4
Motif
Other DBs
NCBI-GeneID: 103464554
NCBI-ProteinID: XP_008406955
UniProt: A0A3P9N6K9
Position
LG5
AA seq 395 aa AA seqDB search
MEELLRAQDAWAQNVSWYNSSHINSTNVGNNTVNPLKRNEEVAKVEVTVLVLVLLLALTG
NLCVLWAIHTTKHSHSRMYYFMKHLSIADLVVAVFQVLPQLIWDITFRFYGPDFLCRLVK
YLQVVGMFASTYMLVLMSIDRCLAICQPLRSVHKGKDRFCVIASWILSLIFSTPQAYIFS
LREVGNGVYDCWGDFVEPWGAKAYITWMSLSIYILPVAILSICYGLICFKIWQNINMKTR
REHFLALTPRPSKGAHPLSRVSSVRLISKAKIRTVKMTFVVVIAYIVCWTPFFFVQMWSA
WDPAAPREDMAFIISMLLASLNSCCNPWIYMFFAGHLFHDLMRSFFCCCRHYLADSSCRC
DQQCRHKSGSSTYVIKNGGSMRSLTHTSSTGGPAH
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggaggaacttttacgcgcacaggatgcttgggctcagaacgtttcctggtacaactcc
agtcatataaacagcaccaatgtagggaacaacacggtaaaccctttaaagcgaaacgaa
gaagtagccaaagtggaagttactgtcctggttctggtgctgctactcgctctgaccggc
aacctgtgcgtcttgtgggctatccacaccaccaagcacagccattctcggatgtattac
ttcatgaagcacctgagcatcgcagatcttgtcgtggcggtgttccaggtcctgccgcag
ctcatctgggacataacgttccgcttttacggacccgatttcctttgcaggctggtcaaa
tacctccaggttgttggcatgtttgcgtcaacctacatgctggtcctgatgtccatcgat
agatgcttagcgatctgccagccgcttcgctcggtgcacaaggggaaagatcgcttctgt
gtgatcgcatcttggatcctcagtctgattttcagtaccccacaagcctacatcttttct
ctcagggaggtcgggaatggcgtttacgactgctggggggacttcgtggaaccctggggt
gccaaagcctacatcacatggatgagtctgagcatttacattcttccagtagcgatatta
agcatctgctacggcctgatatgctttaaaatatggcagaatatcaacatgaaaaccagg
agggagcactttttggctctcacgccgaggccatccaagggcgcacatccactgtcacgc
gtgagcagcgtcagactcatttctaaagccaagatccgcaccgtgaaaatgacatttgtg
gtggtcattgcatatattgtgtgctggactccttttttctttgtccagatgtggtctgca
tgggatcctgctgcaccaagagaagacatggccttcatcatctccatgttgcttgctagc
ctcaacagctgctgtaatccctggatctacatgttctttgctggtcacctgtttcacgac
ctgatgcggagcttcttctgctgctgcagacactatctggccgactcgtcctgccgctgc
gaccagcagtgcaggcacaagagcggctcctccacttacgtcatcaagaacggcggcagt
atgaggagtttgactcacacttccagcacaggggggcccgcgcactga

DBGET integrated database retrieval system