KEGG   Poecilia reticulata (guppy): 103464658
Entry
103464658         CDS       T05149                                 

Gene name
asic1
Definition
(RefSeq) acid-sensing ion channel 1 isoform X1
  KO
K04829  acid-sensing ion channel 1
Organism
pret  Poecilia reticulata (guppy)
Brite
KEGG Orthology (KO) [BR:pret00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pret04040]
    103464658 (asic1)
Ion channels [BR:pret04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   103464658 (asic1)
SSDB
Motif
Pfam: ASC
Other DBs
NCBI-GeneID: 103464658
NCBI-ProteinID: XP_008407120
UniProt: A0A3P9P235
Position
LG5
AA seq 560 aa
MPVRIMCTISFSTDDEPSRGYGKDGFDDYYKRIKQDYSDRGSQDFLDRSNQEDDFAEEED
DASDVDDLATFFGGCSLHGANHIFVEEKKFGIRQGLWATVFTMALSAFLYQVADRVIYYR
QYDHITMLDERSAKNKTFPAISICNYNFIRKSQMSYSDLIFTSPLLGFEEGMAPGFPLAP
EPDRPLGSRFSLDEFYNRTRHRIDEMLLECSFKGLECGPENFREIFTRYGKCYTFNSGQD
GRPLLVTMKGGTGNGLELMLDIQQDEYLPVWGETDETSFEAGIKVQIHTQDEPPFIDQLG
FGVAPGFQTFVSCQEQRLTYLPPPWGDCKSTAMDSDFFSSYSITACRIDCETRYLVENCN
CRMVHMPGDAPYCTPEQYKECADPALDFLVEKDNDYCVCETPCNMTRYGKELSFVKIPSK
ASAKYLAKKFNKTEQYIADNILVLDIYFEALNYETIEQKKAYELAGLLGDIGGQMGLFIG
ASILTVLELFDYLYEVIKYKLCRCMKKKHKGRSSNDRGAVLSLDDVKHHAPCDNLRTPST
YPGNMLPHHPGQGNFEDFTC
NT seq 1683 nt   +upstreamnt  +downstreamnt
atgccggtccggatcatgtgcaccatttctttttccacggatgacgagcccagcagaggg
tacggtaaagacggttttgacgactactacaagcgcataaagcaggactacagcgacagg
ggctctcaggacttcctggacagatccaaccaggaggatgatttcgctgaagaagaggac
gatgccagcgacgtcgacgacctggccactttcttcggtggctgctcgctccacggggcc
aaccacatatttgttgaagaaaagaagtttggcatccgtcagggtttgtgggcaacggtc
ttcaccatggcgctgtccgctttcctataccaggtggctgacagggttatatactaccgc
caatacgaccacatcaccatgctggatgagaggtcagccaagaataagaccttccctgct
atctccatatgcaattacaacttcattcggaagtcccagatgagctacagcgacctgata
ttcaccagccccttgctgggctttgaggaaggcatggcgccgggatttcctctggctccg
gagccggaccgcccgctcgggtcgcgcttcagcctcgatgagttctacaaccgcacccgc
catcggatcgatgagatgctgctggagtgcagcttcaaggggttagagtgtggcccggag
aacttcagagagatatttacacgctacgggaaatgctacacatttaattcaggccaagat
ggacgaccccttctggtgacgatgaagggcggaacgggcaacggcctggagctgatgttg
gacatccagcaggatgaatacctgcctgtgtggggagagactgatgagacatcatttgaa
gctgggatcaaggttcagatccacacgcaggacgagccgccgttcatagaccagctgggc
ttcggagtggctccaggatttcagacctttgtttcctgtcaagagcaacggctgacctac
ctgcccccaccgtggggcgactgcaagtccacagcgatggactccgacttcttcagcagt
tacagcatcactgcctgcagaattgactgcgagacgcgatacctggtcgagaactgcaat
tgcaggatggtccacatgcctggagatgccccgtactgcaccccagagcagtacaaggag
tgtgcagatcctgccttggatttccttgttgagaaagacaatgattactgtgtgtgtgag
accccatgcaacatgactcgatatggcaaagagctgtcctttgtgaagattcccagcaag
gcgtcggccaagtacctcgccaagaaattcaacaagactgaacagtacattgctgataac
attctggttttggatatctactttgaggcgctgaactatgaaaccattgaacaaaagaaa
gcctacgaactggcaggccttctgggcgatatcggaggtcagatgggtctcttcataggc
gccagcatcctcaccgttctcgagctgtttgactacctgtacgaggtgatcaagtacaag
ctgtgcagatgcatgaagaagaaacacaaaggccgcagcagcaatgatcggggagctgtg
ctgagcctggatgatgtgaaacaccatgctccttgtgacaacctgcgtacgccgtctaca
tatcccgggaacatgctacctcaccatccgggccagggcaactttgaagacttcacctgc
tga

DBGET integrated database retrieval system