KEGG   Poecilia reticulata (guppy): 103464826
Entry
103464826         CDS       T05149                                 

Definition
(RefSeq) retinol dehydrogenase 7-like
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:pret00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    103464826
Enzymes [BR:pret01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     103464826
SSDB
Motif
Pfam: adh_short adh_short_C2 KR DUF1776 Phage_rep_O
Other DBs
NCBI-GeneID: 103464826
NCBI-ProteinID: XP_008407417
UniProt: A0A3P9PP51
Position
LG5
AA seq 348 aa
MFFEQFRGQKQTPEGNMDTQYIYELLGENASYYIAASFALLWILVWLYRDSLEIENLSDK
YVFVTGCDTGFGNLLCKKLDRRGFRVLAGCLTEKGADDLKRVTGPHLKTVLLDVTSQSSI
QAAMEWTKKEVGDXGLWGIVNNAGRSLPMGPSEWMRVEDFHSTLKVNMNGVIAMTMXFLP
LVKKAPGRIVNVASVLGRVAANGGGYCISKFAVESFSDCLRRDISYFGIKVCIIEPGFFK
TAVTNLDPIERELHRLWNQLSPEVKASYGEKYLDNYIKIQRLIMNAVCDSDLTKVTSCME
HALTAAHPRTRYSAGWDAKLLWIPLSYMPSFVVDIGLKLVLPRPSKSV
NT seq 1047 nt   +upstreamnt  +downstreamnt
atgttttttgagcagtttcgaggccaaaaacaaactcctgaaggcaacatggatacacag
tatatatacgaacttttaggagaaaatgcctcgtactacattgcagcttcctttgctttg
ttgtggattctggtatggctatacagagacagcctggagatagagaacctttctgacaag
tatgtcttcgtgactggctgtgacactgggtttggcaaycttctgtgcaagaagctcgac
cgtagaggttttcgagttctggctggctgtctcacagagaagggggctgatgatctgaaa
agagtgacggggcctcaccttaagacggtcttgctggatgtgaccagtcagagcagcatc
caggcagctatggagtggaccaagaaggaggttggagataraggactttggggtattgtg
aacaatgctgggcgttctttgcccatgggtccttcggagtggatgcgagtggaggatttc
cacagcacactgaaagtgaacatgaatggagtcattgccatgactatgrccttcctgccc
ctcgttaaaaaggcccctggacgtattgtaaatgtggcatctgtcctcggcagggtggct
gcaaatggtggcgggtactgcatctccaagtttgcagtggagagtttctctgactgcttg
aggagagatataagctactttggaatcaaagtgtgcatcattgagccagggtttttcaag
acagcagttaccaaccttgatcccattgagagggagctgcaccgtctctggaatcaactc
agccccgaagtaaaagcaagctatggagagaagtacctggataactacatcaagatccag
cgtttgatcatgaatgctgtgtgtgactcggacctcaccaaggtgaccagctgcatggag
cacgctctgactgcggctcacccacgcactcggtacagcgccggctgggatgctaagctt
ctctggatccctctgtcttacatgccttcctttgtggttgatattggactaaagctggtg
ctgcctcgtccttccaagagtgtgtaa

DBGET integrated database retrieval system