KEGG   Poecilia reticulata (guppy): 103464897Help
Entry
103464897         CDS       T05149                                 

Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type 1-like isoform X1
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:pret00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    103464897
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pret01001]
    103464897
Enzymes [BR:pret01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     103464897
Protein kinases [BR:pret01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   103464897
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal Kdo RIO1 APH YrbL-PhoP_reg Hypoth_Ymh Tyrosinase ATP-grasp_3
Motif
Other DBs
NCBI-GeneID: 103464897
NCBI-ProteinID: XP_008407514
Position
LG5
AA seq 390 aa AA seqDB search
MGNHIVSDYHHKKMPLGEDGHAWKKKTSDVKEKYDFKDILGTGAFSEVVLAEEKKTQRLV
AIKCIPKKALEGKENSIENEIAVLHKIKHPNIVSLEEIFESKSHLYLVMQLVSGGELFDR
IIEKGFYTEKDASKLIQQILDAVKYLHDMGIVHRDLKPENLLYYSMDEDSKIMISDFGLS
KIEGSGSVMSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDAKL
FEQILRAEYEFDSPYWDDISDSAKDFIVHLMEKDSNERFTCEQALQHPWIAGDTALDKNI
HESVSAQIKKNFAKSKWKQAFNATAVIRHMRRLQLSTGSEGPGPTLSDPCQAHLMEEEGA
LCEGGCSQNMDGGADPLSNCTYRCHPASSV
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaccatattgtttctgactaccaccacaagaagatgccgctgggtgaggacgga
cacgcctggaaaaagaagacctctgatgtcaaggagaagtatgatttcaaagacattctg
ggaacgggagctttctctgaggtggtcttggctgaggagaagaagacgcagagattggtg
gctattaagtgtattcccaagaaggcattggaaggcaaggaaaacagcatcgagaatgaa
atcgcagttctgcacaagattaagcatccaaacattgtgtctctggaagagatattcgag
agtaaatcacacctctaccttgtcatgcaactggtgtcgggtggagagttgtttgatcgt
atcatagagaagggcttctacacagagaaagatgcaagtaagctaattcaacagattctg
gacgctgtaaaatacctccacgacatgggcattgtgcaccgtgaccttaagccagagaac
ctgctgtactacagcatggacgaagactcaaaaatcatgatcagtgacttcggtctgtct
aagatcgagggctcgggcagcgtgatgtcgacagcctgtggaactcctggatacgtcgct
cctgaggttttggcacagaagccgtacagtaaagctgtggattgctggtctattggggtc
atagcatatattctgttgtgtggatacccacctttctatgatgaaaatgatgccaaactg
tttgaacaaatcctgagagcagaatacgagtttgattctccttactgggacgatatctct
gattcagctaaagactttatagtgcatcttatggaaaaagattctaatgaacgcttcacc
tgtgagcaggctctgcagcacccttggattgctggagataccgccctggacaagaacatt
catgagtctgtcagtgctcagatcaagaaaaactttgctaagagcaaatggaagcaagca
ttcaacgccaccgcagtgatccgtcacatgaggcgtctccagcttagcactggcagtgag
ggacctggccccaccttgtccgatccatgccaagcccatctgatggaagaggaaggagcg
ctttgtgaaggtggttgctcccagaacatggatggaggagcagaccctttgtccaactgc
acctaccgctgtcacccagccagtagtgtgtga

DBGET integrated database retrieval system