KEGG   Poecilia reticulata (guppy): 103465095Help
Entry
103465095         CDS       T05149                                 

Gene name
suclg2
Definition
(RefSeq) succinyl-CoA ligase [GDP-forming] subunit beta, mitochondrial
  KO
K01900  succinyl-CoA synthetase beta subunit [EC:6.2.1.4 6.2.1.5]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret00020  Citrate cycle (TCA cycle)
pret00640  Propanoate metabolism
pret01100  Metabolic pathways
pret01200  Carbon metabolism
Module
pret_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pret_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pret00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    103465095 (suclg2)
   00640 Propanoate metabolism
    103465095 (suclg2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pret04147]
    103465095 (suclg2)
Enzymes [BR:pret01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     103465095 (suclg2)
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     103465095 (suclg2)
Exosome [BR:pret04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103465095 (suclg2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp
Motif
Other DBs
NCBI-GeneID: 103465095
NCBI-ProteinID: XP_008407871
Position
LG5
AA seq 417 aa AA seqDB search
MSAGAANGSLAVIQCSWLTPRRWLNLQEYQSKKLMQDSGVAVQRFYVADTASEAQEAAKR
LNAKEIVLKAQILAGGRGKGVFDSGLKGGVHLTKDPAVVGELAKKMLGFNLITKQTPKDG
VKVKTVMVAEALDISRETYFAILMDRACNGPVMVGSPQGGMDIEEVAATTPELIFKEVID
IYKGVQDDQALRMAANLGFKGPLQRQAADQIKRLYDLFLKVDATQVEVNPLGETPEGQVV
CFDAKINFDDNAEFRQKDVFAMDDMTESDATEMEAAKWDLKYIGMDGNIACFVNGAGLAM
ATCDIIDLHGGKPANFLDLGGGVKERQVYEAFKLLTADPKVEAILVNIFGGIVNCAIIAN
GITKACRELELKVPLVVRLEGTNVHEAKRILTESGLPITAADNLDDAAKKAVAAIRK
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctggtgcagcaaacggctccttagctgtaattcagtgcagctggctgaccccc
aggagatggctgaacctgcaggagtaccagagcaagaagctgatgcaggacagcggcgtg
gcggtccagcgcttctacgttgccgacacagcgtcggaggcgcaggaggcggcaaaaaga
ctcaatgccaaggaaatcgtcctgaaagctcagattctagccggtgggagaggcaagggt
gtgttcgacagcggccttaaaggtggagtgcacttaactaaggaccccgcagttgttggc
gagctggctaaaaagatgctcggcttcaacctgattaccaagcagacgcccaaagacgga
gtgaaagtgaaaacggtgatggtcgccgaggctctggacataagcagagagacgtatttt
gccatcctaatggaccgggcctgtaatggtccagtaatggtgggaagcccccagggaggg
atggacatcgaggaggtggccgccaccaccccagagctcatctttaaggaagtcatagat
atatataaaggcgtgcaagacgaccaggcgcttcgcatggcagctaatttgggtttcaaa
ggacctctgcaaagacaggcagcggatcagattaagaggctctatgatctgttcctgaaa
gtcgacgccactcaagttgaagtcaatccgctcggagagactcccgaaggacaagtggtc
tgctttgatgccaagatcaactttgacgacaacgccgagttccgtcagaaagatgtgttc
gccatggatgatatgacggagagcgacgccacggagatggaggcagccaagtgggatctt
aaatacatcggaatggatggaaacatcgcctgctttgtgaacggagccggtctggccatg
gcaacatgtgacatcattgacctccatgggggaaagccggctaatttcctggacctcggg
ggcggtgtcaaagagaggcaggtgtacgaggcttttaagctgctgactgctgacccaaag
gtcgaagccatcttggtcaacatctttggagggattgtcaactgtgccatcattgccaac
ggcatcaccaaagcctgtcgagagctggagctcaaggtcccgctggtggtcaggctcgaa
ggcaccaacgttcacgaagctaagaggatcctgaccgagagcggcctgcccatcacagca
gccgacaacctggatgacgccgccaagaaagcggtggccgccatcaggaaatga

DBGET integrated database retrieval system