KEGG   Poecilia reticulata (guppy): 103466257
Entry
103466257         CDS       T05149                                 

Definition
(RefSeq) N-acyl-aromatic-L-amino acid amidohydrolase (carboxylate-forming) B-like
  KO
K18458  N-acyl-aromatic-L-amino acid amidohydrolase [EC:3.5.1.114]
Organism
pret  Poecilia reticulata (guppy)
Brite
KEGG Orthology (KO) [BR:pret00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    103466257
Enzymes [BR:pret01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.114  N-acyl-aromatic-L-amino acid amidohydrolase
     103466257
SSDB
Motif
Pfam: AstE_AspA
Other DBs
NCBI-GeneID: 103466257
NCBI-ProteinID: XP_008409949
UniProt: A0A3P9NE56
Position
LG1
AA seq 308 aa
MERTSLPPIHNVAICGGTHGNELTGVYIVREMQKQKMEKAGSVSITTVETNPRAVAAGRR
YTEMDLNRCFTDVLLSSPTTESTPYEVRRAQELNAQLGPKGSAEAVDLLIDLHNTTSNMG
LCFIFYSIDWITLHIYKYIENNLSSVPVRAIQLDIPSSEAYSLESVGKHGFAIEVGPQPN
GVLRADIFNVVKEALDLTLQWLQKFSSGHSFEGGTVEAYTFVKSVDYPRDSAGKATAVIH
QDLQDNDFKLLRSGDPVFQTFSGDILKYEGEDLYPFFVNECAYYEKKIAFHLAQRKTYSF
PHISVKND
NT seq 927 nt   +upstreamnt  +downstreamnt
atggagcgcacctctctcccaccaatacacaatgtcgccatttgcggtggaacccacggg
aatgagttgactggggtgtacattgtgagggaaatgcagaaacagaagatggagaaagcg
gggtctgtttctataaccactgtcgagaccaatccaagagccgtggctgctggcagacga
tacacagagatggatctgaaccgctgcttcacagatgtcttgctgagttcccccacaaca
gagtcaaccccgtatgaggtgaggcgagcccaggaactgaacgctcagctggggcccaaa
ggaagcgcagaggctgttgacctgctcatagatctgcacaacaccacttccaacatgggc
ctgtgcttcatcttctactcaatagactggatcactctgcacatttacaagtacatagag
aataacttgagctctgtgcctgtgagagcgatccagctggacattcccagctccgaagct
tattccctggagtcagtgggcaaacatggctttgcgatagaagttggcccgcaacccaac
ggtgtgctcagagctgatatcttcaacgtggtgaaagaagcattggatctcacattacag
tggcttcagaaattcagttctgggcacagttttgagggcggcacagtggaagcatacact
tttgttaaaagtgttgattacccacgagactcggctggtaaagctactgctgtcatccac
caagacctacaggataatgactttaagcttctgcgatcaggggatcccgtcttccagaca
ttttctggggatattttgaagtacgagggagaagacctctaccctttctttgtgaatgaa
tgcgcctactacgagaagaagattgctttccatttagctcagagaaaaacgtacagcttt
ccacacataagcgtgaaaaatgactga

DBGET integrated database retrieval system