KEGG   Poecilia reticulata (guppy): 103469144Help
Entry
103469144         CDS       T05149                                 

Definition
(RefSeq) sphingosine kinase 1-like
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret00600  Sphingolipid metabolism
pret01100  Metabolic pathways
pret04020  Calcium signaling pathway
pret04370  VEGF signaling pathway
pret04371  Apelin signaling pathway
Module
pret_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:pret00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    103469144
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    103469144
   04371 Apelin signaling pathway
    103469144
   04020 Calcium signaling pathway
    103469144
Enzymes [BR:pret01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     103469144
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat
Motif
Other DBs
NCBI-GeneID: 103469144
NCBI-ProteinID: XP_008414886
UniProt: A0A3P9PPZ5
Position
LG8
AA seq 564 aa AA seqDB search
MEKDASAPDPSRQCNGFSGVLYGEFTDTLNDGVRYSVSLTESALTIQRISSSPDRTKVVF
NLSDCIGCRAYKGPDSADIGAYFTAYFYPFKRRWMSTGVARQRVEQCFRVALVQDPLVNL
REAERWAHAIRDASVLQAPRRDGVTYTELRRPCRTMILVNPHSGRGQALQLFTGHIQAML
TEASVPYTLVITEHQNHARELVRNADLTQWDALVIMSGDGLLFEVINGLMEREDWQQAIQ
TPLGMLPGGSGNALAASIHHYSQSPPAWNEELLLSCGFMLCKGLVGPLDLVSVHLASSQR
LFSFLSLAWGFVADVDIESEKYRHVGAIRFLMGTLVRLASLRVYQGRLAYLPAKEVPKPP
NERVKATRPPFTSQQPSLCSSLPCHLVPRTSPKQSSVKNCVDTNLNQNSITNSSSVITNM
RPETHGNNKTASPTDSLLPSLDQPVPENWTVVNEEDFVLVLAIYQSHLAEDLWTVPGAMA
DDGLIHLLYVTAGISRPALLRLFLAMERGSHLACGCPHLVYEKVRALRLEPVSQQGMITV
DGEVVEYGPIQAQVHPRMARLICG
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atggagaaagacgcctcagcgccggacccatcccggcagtgcaacgggttctcgggcgtg
ctgtacggagagttcaccgacactctcaacgacggggtgcgctactcggtgagcctgacg
gagagcgccctgaccatccagaggatctcctcgtctcccgaccggacgaaggtggtgttt
aacttgagcgactgcatcggctgtcgggcgtataaagggccggacagcgcggacatcggc
gcttactttacggcttatttctacccattcaagaggcgctggatgagcaccggagtggcc
cggcagagggtggagcagtgctttcgggtcgctctggtccaggacccgctcgtcaacctc
cgggaggctgaaagatgggctcatgccatcagagatgcttcggtgctgcaggctcctcgg
agagacggtgtgacgtacacggagctgaggagaccttgcagaaccatgattctggtgaac
ccccacagcggacggggacaggctctccagctgttcaccggccacatacaggccatgctc
accgaggcctccgttccctacacgctcgtcatcacagagcaccagaaccacgcgcgggag
ctggtgaggaacgccgacctgacgcagtgggacgcgctggtcatcatgtctggtgacggg
ctgctgtttgaggtgataaatggtctgatggagcgtgaagactggcaacaggccatccag
actcctctaggtatgctgccaggtggctctggcaatgccctggccgcatccatccaccac
tactcgcaatcgcctcctgcctggaacgaggagctgctcctgagctgtggcttcatgctg
tgcaaaggtctggttggtcctcttgacttggtgtcggtccatttggcctccagtcagcgc
ctcttctccttcctctccttggcttggggctttgtggcagatgtggatatcgagagcgag
aagtaccgtcacgttggagctatacggttcctaatgggcaccctggtgcgtctggcctcg
ctcagagtatatcagggcaggttagcgtacctgccagctaaagaggtaccaaagcctcca
aacgaaagggtgaaggcgacccgtcctccgttcacatctcagcagccatctctctgttcg
tcccttccttgtcatctcgttcccagaacttcgccaaagcagagctctgtcaaaaactgc
gtcgatacgaacctgaaccaaaactccatcaccaactcctccagcgtcatcaccaacatg
aggcccgagacgcatggcaacaataagactgcatcacctacggattctctcctccccagc
ctggaccagccggtccctgaaaactggacggtggtcaatgaggaagactttgttctggtg
ctggctatttaccagtcccacctagcggaggacctgtggacggtgccgggagcgatggcg
gacgatgggctgattcatctgctttacgtgacggcggggatatcccggcccgccctcttg
cgtctcttcctcgccatggagaggggttcccatttagcgtgcggttgcccacatcttgtg
tacgaaaaggtgagggccctgcggttagagcccgtctcacaacagggcatgatcaccgtg
gacggagaggtggtggagtacggccccatccaggctcaggtccaccccagaatggccagg
cttatatgcggatga

DBGET integrated database retrieval system