KEGG   Poecilia reticulata (guppy): 103469480Help
Entry
103469480         CDS       T05149                                 

Definition
(RefSeq) heat shock 70 kDa protein 1-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret03040  Spliceosome
pret04010  MAPK signaling pathway
pret04141  Protein processing in endoplasmic reticulum
pret04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:pret00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    103469480
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    103469480
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103469480
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103469480
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pret01009]
    103469480
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:pret03041]
    103469480
   03009 Ribosome biogenesis [BR:pret03009]
    103469480
   03110 Chaperones and folding catalysts [BR:pret03110]
    103469480
   04131 Membrane trafficking [BR:pret04131]
    103469480
   03051 Proteasome [BR:pret03051]
    103469480
   03029 Mitochondrial biogenesis [BR:pret03029]
    103469480
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pret04147]
    103469480
Protein phosphatases and associated proteins [BR:pret01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     103469480
Spliceosome [BR:pret03041]
 Complex B
  Other components
   Prp19 complex
    103469480
 Complex C
   Prp19-CDC5 complex
    103469480
Ribosome biogenesis [BR:pret03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    103469480
Chaperones and folding catalysts [BR:pret03110]
 Heat shock proteins
  HSP70 / DNAK
   103469480
Membrane trafficking [BR:pret04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    103469480
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    103469480
Proteasome [BR:pret03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    103469480
Mitochondrial biogenesis [BR:pret03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    103469480
Exosome [BR:pret04147]
 Exosomal proteins
  Proteins found in most exosomes
   103469480
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70
Motif
Other DBs
NCBI-GeneID: 103469480
NCBI-ProteinID: XP_008415405
Position
LG8
AA seq 89 aa AA seqDB search
MKSSVEDESLKGKISQEDKKKVVDKCEETISWLENNQLAEKDEYQHQQKELEKVCNPIIS
RLYQGGRPTGSCREQAGAHSQGPTVEEVD
NT seq 270 nt NT seq  +upstreamnt  +downstreamnt
atgaagagcagcgtggaggacgagagcttgaagggcaagatcagccaggaggacaagaag
aaggtggtggacaagtgcgaggagaccatcagctggctggagaacaaccagctggctgag
aaagacgagtaccaacaccagcagaaagagctggagaaggtgtgcaaccccatcatcagc
aggttgtaccagggagggaggcccactgggagctgcagagagcaggcaggggcccacagc
caggggcccactgtggaggaggtggactga

DBGET integrated database retrieval system