KEGG   Poecilia reticulata (guppy): 103469953
Entry
103469953         CDS       T05149                                 

Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
pret  Poecilia reticulata (guppy)
Brite
KEGG Orthology (KO) [BR:pret00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pret01002]
    103469953
Enzymes [BR:pret01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     103469953
Peptidases and inhibitors [BR:pret01002]
 Metallo peptidases
  Family M1
   103469953
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 103469953
NCBI-ProteinID: XP_008416263
UniProt: A0A3P9NT98
Position
LG9
AA seq 938 aa
MFPLLLVLFVSIYPSSGAQLPNQDQAKQIPVATNGEPFPWDRMRLPVTISPLHYDLTIHP
NLTSLDFTGVVRISLDVKEDTSIVVLHAKQMHISNVVLLAAEGVRPLRVLEYPRFHQLAL
LSESVLTKGRKYEVQLEFAANLSDSFHGFYKGSYRTSSGEVRAIASTQFEATFARGAFPC
FDEPAFKANFTIRIMREPRHIAISNMPKVKTVELPGGLLEDHFDTTVKMSTYLVAYIVSD
FLSVSKTTKHGVKISVYAVPEKIDQTAFALDAAVKLLDFYDDYFDIPYPLPKQDLAAIPD
FQSGAMENWGLTTYRETGLLFDPDKSSASDKLGITKVIAHELAHQWFGNLVTMEWWNDLW
LNEGFAKFMEFISLDITYPELHVDDFFLGKCFEAMEVDSLSSSHPVSTPVENPTQIQEMF
DDVSYDKGACILNMLRDFLSPEAFEIGIIRYLKRYSYQNTVNSHLWESLTDICSSDALDE
GRLKHTEFCSKRKLQSGSSKWYSDDELDVKTIMDTWTLQEGFPLVTVEVKGREVRLSQER
FLRTDDPSLTEGFLWQIPLTYMTSASSTVHRFLLKTKTDVLYLPEEVDWVKFNVNMSGYY
MVHYAGEGWSSIIKLLQYNHTALSGNDRASLIQNVFQLVSVGKVRLDTALDLSLYLSKES
QIMAVTQGFGELVPLYKLMEKRDMTVLENQMKGYIVDLFRDLIDRQEWSDSGSVSERVLR
SYLLLFACVRNHPPCVAKATKLFNQWKDSDGTMSLPVDITMAVFVIGARTPEGWDFLFEK
YRTTLQMSVKSRIKSAMTVTYLKDKLKWMMEQSLIGEVMKTQDLPDVVVSVGRNPHGYKL
AWDFLRANWHTMIKKFDLGSHSVSYMLLGVTNQYSTREMLHEIRSFFDSLTEETGSKMRC
IQQTYETIEDNIRWTDTNFPLLEAWLNKHQHRPPHEDL
NT seq 2817 nt   +upstreamnt  +downstreamnt
atgtttcccctcctgctggtgctctttgtttctatttatccctcatctggagctcaactc
ccaaatcaagatcaagccaaacagattcctgtagccaccaacggcgaacccttcccctgg
gaccgcatgaggcttcccgtaaccatcagccccttgcactatgacctgaccatacaccca
aacctcacctccctggacttcactggggtggttcgcatcagtctggatgtgaaagaagac
accagcatcgttgtcctccatgccaagcaaatgcacatatccaacgtggttctcctggct
gctgagggcgtccggcctctacgggtgctggagtatcctcgattccatcagcttgctctg
ctgtctgaatcagttctgaccaagggcagaaagtatgaggtccagctggagtttgctgca
aacttatctgacagctttcatggtttctacaaaggcagctaccgtacgagcagcggggag
gtccgggccatagcatctacgcagtttgaggcgaccttcgctcgtggagccttcccctgt
tttgacgagcctgccttcaaagccaacttcaccatacggatcatgcgtgagccacgccac
attgccatttccaacatgcccaaggttaaaacagtggagttgcctggcggtttgcttgag
gatcactttgacacgaccgtaaagatgagcacttacctggtggcctacatcgtctctgac
ttcctgtctgtgagcaaaacaactaagcatggagttaagatctctgtctatgccgtacca
gagaagatcgatcagacggcctttgctttggatgctgcagtgaagttgttagacttctat
gatgattactttgatatcccatatccactccccaaacaggacctggctgctatcccggac
tttcagtcaggcgcaatggagaactggggactgaccacctacagagagactggccttctc
tttgatcctgacaagtcctctgcctccgacaaactgggcatcaccaaggtcattgcccat
gagcttgctcatcagtggtttggaaacctggtgacaatggagtggtggaatgacttgtgg
ctcaatgagggttttgccaagttcatggagttcatttccctcgacatcacctacccagag
cttcatgtggatgacttcttcttgggcaagtgttttgaggcgatggaggtagactctctg
agctcgtctcatccagtctccacaccagtggaaaaccccacgcagatccaggagatgttt
gacgacgtgtcttatgacaagggggcatgtatcctgaacatgctgcgggacttcctgagt
cctgaggcatttgagatcggcatcatccgatacctgaagcgctacagctaccagaacacc
gtgaacagccacctgtgggagagcctgactgatatctgcagctcagatgctctggatgaa
ggtcgactgaaacacacagaattctgctctaaacgcaaactccagtctggatcctctaag
tggtactctgatgacgagcttgatgtcaagactatcatggacacctggacactgcaggag
ggcttcccactggtcacagtagaggtcaaaggtcgggaggtcagactcagtcaggagcgt
ttcctgaggacagacgatccctcgctcactgaaggattcctgtggcagattccactaacg
tacatgaccagtgcttccagcacggttcatcgtttccttctcaagacaaagacggatgtg
ctctacctgccagaggaagtggactgggtgaagtttaatgtcaacatgagtggctattac
atggtccactatgctggtgagggttggagctccatcatcaaactgctgcagtacaaccac
acggctctctctgggaacgaccgggccagcctcatccagaacgtcttccagctggtcagt
gttgggaaggtgaggctggacacggctctggatctgtccctttatctttccaaagagtct
cagatcatggctgtgacccagggcttcggagagcttgtgcctctgtacaaactgatggag
aagagagacatgacagttctggaaaatcagatgaagggttacattgtggatcttttccgg
gatctgattgatcgtcaagaatggagtgactccggttcggtgtctgagcgagtgctgagg
agttacctgctgctgttcgcttgcgtcaggaatcatcctccatgtgtcgccaaagccacc
aagctctttaaccagtggaaggattcggatggcaccatgagcctccctgttgacatcact
atggctgtgtttgtgattggagcacgaacaccagaggggtgggacttcctgtttgagaaa
taccgcactactctgcagatgtcggtcaagagccgcataaagtctgccatgaccgtcacc
tatctgaaggacaagctcaagtggatgatggagcagagtctgataggagaggtgatgaag
acccaggacctcccagatgtggtcgtctctgttggaaggaatcctcatggttacaaactg
gcctgggactttctccgagccaactggcacacaatgatcaagaagtttgaccttggctct
cactctgtatcatacatgttgcttggcgtgaccaaccaatactctaccagggagatgctc
cacgagatacggagcttcttcgactcgctgacagaggaaaccgggtcaaaaatgaggtgc
atccagcagacctacgagaccattgaggataacatccgctggactgacaccaactttcct
ctgctagaggcctggctgaacaagcaccaacacagaccacctcacgaagacttatag

DBGET integrated database retrieval system