KEGG   Poecilia reticulata (guppy): 103470038Help
Entry
103470038         CDS       T05149                                 

Gene name
sept5
Definition
(RefSeq) septin-5 isoform X1
  KO
K04557  septin 5
Organism
pret  Poecilia reticulata (guppy)
Brite
KEGG Orthology (KO) [BR:pret00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pret04131]
    103470038 (sept5)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pret04812]
    103470038 (sept5)
Membrane trafficking [BR:pret04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Septins
    103470038 (sept5)
Cytoskeleton proteins [BR:pret04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 2
     103470038 (sept5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Septin RsgA_GTPase MMR_HSR1 GTP_EFTU AAA_23 AIG1 AAA_16 Roc Ras AAA_22 AAA_29 AAA_24 Dynamin_N AAA_7 ABC_tran NACHT
Motif
Other DBs
NCBI-GeneID: 103470038
NCBI-ProteinID: XP_008416381
Position
LG9
AA seq 390 aa AA seqDB search
MDAIMLQEKLVERLLCPRVRTARQKEKQYVGFATLPNQVHRKSVKKGFDFTLMVAGESGM
GKSTLVNSLFLTDLYKDRKLLNAEERINQTVEIIKHTVDIEEKGVKLKLTIVDTPGFGDA
VNNNECWKPITDYIDQQFEQYFRDESGLNRKNIQDNRVHCCLYFIPPFGHGLRPVDVEFM
KALHEKVNIIPLIAKADCLTPNEIKKLKDRIREEIDKFGIKVYQFPECDSDEDEEFKQLD
KELKECTPFAVIGSNTVVEARGQRVRGRLYPWGIVEVENQSHCDFVKLRNMLIRSHMHDL
KDVTCDVHYENYRAQCIQEMTRFVSLCEKESDEEKSKLAQDNRMESPIPILPLSTPDADT
EKLIKMKDEELKRMQEMLNKMQQQMHDKDQ
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atggatgccatcatgctgcaagagaaactggtggaacggcttctgtgcccacgagtgaga
accgcaagacagaaggagaaacagtatgtgggttttgcaactctgccaaaccaggtccac
aggaaatctgtgaagaaaggcttcgatttcaccctgatggttgcaggagagtctggtatg
ggaaagtccactctggtcaacagtctgttcctcacagacctctacaaagacaggaagtta
ctaaatgccgaagagcggattaaccaaactgtggagatcatcaagcacaccgtcgacatc
gaggagaagggagtgaagctcaagctgaccatagtggacacgccggggttcggagacgcc
gttaataacaacgagtgctggaagccaatcacagattatatcgatcagcagtttgagcaa
tacttcagggacgagagcggcctgaacaggaagaacatccaggacaacagagtccactgc
tgcctctacttcatccctccctttggccatggcttacgtcccgtggacgtggagttcatg
aaggctcttcatgaaaaagtgaacatcattcctctcatcgcaaaagccgactgcctcact
cccaatgagataaaaaagcttaaagacagaatacgagaggaaatagacaagtttgggatc
aaagtgtaccagtttcctgagtgtgactctgacgaggacgaggagtttaagcaactcgac
aaagaactgaaggagtgcacgccgttcgctgtgattggcagcaacaccgtggtggaggcg
aggggacagcgggtcagaggaaggctgtacccctgggggatcgttgaagtggaaaaccag
tcgcactgcgactttgtgaaactgaggaacatgctgatccgctcgcacatgcacgacctt
aaagatgtaacctgcgacgtccactacgaaaactacagagcgcagtgcatccaggagatg
actaggtttgtctctctgtgtgagaaagagtctgatgaggagaaaagtaaactggctcag
gataaccggatggagagcccaatccccatcctgccgctgtccactccagacgcagacact
gagaagctaatcaagatgaaagacgaggagctgaagcggatgcaggaaatgttgaataag
atgcagcagcagatgcacgacaaggatcagtga

DBGET integrated database retrieval system