KEGG   Poecilia reticulata (guppy): 103470625
Entry
103470625         CDS       T05149                                 

Gene name
adamts13
Definition
(RefSeq) A disintegrin and metalloproteinase with thrombospondin motifs 13
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
pret  Poecilia reticulata (guppy)
Brite
KEGG Orthology (KO) [BR:pret00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pret01002]
    103470625 (adamts13)
Enzymes [BR:pret01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     103470625 (adamts13)
Peptidases and inhibitors [BR:pret01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   103470625 (adamts13)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 ADAM_CR_2 Reprolysin TSP1_CCN TSP1_spondin Reprolysin_4 Reprolysin_3 Reprolysin_5 Reprolysin_2 ADAM_spacer1 Peptidase_M10
Other DBs
NCBI-GeneID: 103470625
NCBI-ProteinID: XP_008417455
UniProt: A0A3P9P6E7
Position
LG9
AA seq 1411 aa
MSRREHIYIYIYSLSVAAEQVDIQKKGGEKMFIMTAVCLLLLLPGFSALMGSPQDELQVK
FSALDSSADTTVSDRLRRSTLIPDITHLELLVVVGPDVQQVHKQDTERYILTNLNIASEL
LRDMTLGANMRVHLVRMIILSEPEPEIQMSTNITSSLRSVCDWGRRINPSNDSDPLHADL
LLYITRYDLELPDGNKQVRGVTQLGGVCSKDWSCVITEDTGFDLGITIAHEVGHSFGIDH
DGSANGCSRSGFMMASDGGYNSVDLTWSPCSRQQLLTFFSEGRAECVKDFPALRGSLQDW
KPGLYYGVDDQCRIAFGSTARACSFSNPDLPACRALSCHVKPEDISSCKRLLVPLLDGTE
CAPNQWCLKGRCVSPDDFGVSVVVNGSWSRWSGFSSCSRTCGGGVMLRTRECNNPRPAFG
GNDCDGPDIEAELCNQLPCERTQLDFMAEQCSQTDPQPLYLLPNTASFYKWIPAIGFVKG
DEQCRYMCQSDGESFIVSRGSYFADGTRCKSDVSTPYGATAACLRGRCQVFGCDGVLHSG
KAWDVCGVCGGDGSTCILTSDSYSGGGAKDYNTFLTLPVNATQVHVVNRAPVFTHLAVMV
GDQYIVSGSGTMALNTTHPSPLDDDYVEYSLHLTPDLLPEMEEVVVPGPLKQEITMQVYR
KYGKEYGEKTNPNISFQFYVPRSKSLTDSSPRGKWAPLATPCSVTCGLGIQRNEHVCVDE
DTNKLLKPHYCKASPPPTALHTTCQLPSCPPRWDAGNFGVCSASCGGGFRVRHVRCVQKR
EHIVVKVPDSQCSTDTAPHPVEKCNLHHCPARWSVSEPGNCSAVCGPGEAERSVSCVRQE
GGLDVEVDHSFCLNQIRPPDSVPCVVDVCPIGWDSKGEERPSLKSGLLPRSRQTPVYVWS
PVVSQCSRSCGNGTLQVWFSCVDHQTRLGVPDFHCDSSSKPEPHTEMCGFSPCPPMWRSK
QGVCSVTCGGGVAKRVLYCAREADGEEEEEVLEDYNCSGFPKPTAVVSCNTHSCPARWKV
FRTSPCSVSCDLGVAQRNVSCVQFVHGKESVVPEDGCRAAVQPATTVPCLVQACTFKWEV
KPWSQCSASCGYGIQSRAVSCMGPPKPEPLSPLFCMHMPKPITIRGCDTGSCRDVALNKT
TQTLKANSTEKPLPSPPPVHKDAPRRRLGSLPPRPTETMAIVETTTATPTPKPNACGQLL
LEESGTVDLHNAPSRCTVSIGRPLDEVISITLISSSLDCRKREYVAFFDRLAFVRKCVQA
AGSELTTRTNVLLVRQSVVTPGNGVVFIYRSKKNTKRSHHQDCDIQLFSPSGIFENPVTS
NTSHTCRVLINAPPSVKIRIQALHIALPFNTTGTQSTYIMIRDMDALKTNVFNGQQLFLW
HSSGNMAEVEFHGDYLYSKGTFRAEYSFVRL
NT seq 4236 nt   +upstreamnt  +downstreamnt
atgagcaggagggaacatatatatatatatatatatagcctgagcgtcgcagcagagcag
gtagacatacagaaaaaaggaggggaaaaaatgtttattatgactgcagtctgtcttctg
ctcctactgcctggcttcagcgctctaatgggatctcctcaggatgagctacaggtcaaa
ttctccgctttagattcctctgcagacaccacagtaagcgaccgtttgcgtcgctcaact
ctgattcctgacatcacgcatctggagctgctggtggtcgtggggccggacgtccagcag
gtccacaagcaggacacggaacgatacatccttaccaacctcaatatcgcctctgagctg
ttgagagacatgaccctgggtgccaacatgagggttcacctggttcgcatgatcatcctg
tcggagccagagccagagatccagatgtccaccaacatcacctcgtctctgaggagtgtg
tgcgactggggtagaaggatcaacccctccaatgactcagacccgctacacgctgacctc
ctgctgtacataacaaggtatgacctggagctgcccgacgggaacaagcaggtcaggggg
gtgacacagctgggaggggtctgctccaaagactggagctgtgtgatcacagaggacacg
ggattcgacctgggcatcaccatcgctcacgaagtcggccacagcttcggaatcgaccac
gacggatcggcgaacggctgcagtcggagcggcttcatgatggcctcggacggaggctac
aacagcgtggatctgacctggtccccctgcagcagacagcagcttctcaccttcttcagt
gaagggagagctgaatgtgtgaaggatttccccgcactgagaggctccctgcaggactgg
aagcccgggctgtattacggcgttgacgaccagtgtcgcatagcctttggcagcactgcc
agagcctgctctttctccaatcctgacctgccggcttgccgtgctctgtcctgtcatgtt
aaacccgaagacatcagctcctgtaaacgcctcctggttccactgctggatggaacagag
tgcgcacccaatcagtggtgtctgaagggacgctgtgtgtccccagatgacttcggcgtc
tctgtcgtagtcaacggctcctggtccagatggtctgggttttcctcctgctcccggacg
tgtggcggaggggtcatgctccgtacgagggaatgcaacaaccccagacctgcttttgga
gggaatgactgtgacggcccagatatcgaggctgaactttgtaaccagctgccttgcgag
cggacccagttggacttcatggcagagcagtgttcccaaacagacccccagcctttatac
ttgcttcccaacactgcctccttctacaaatggatccctgctatcggctttgtcaaaggg
gatgagcagtgcagatacatgtgtcagtcagatggagagagcttcatagtgagccgtggg
tcttattttgcggatgggactcgctgcaagtcagacgtctcaactccttacggcgcaaca
gctgcttgtcttcgagggagatgtcaggtgttcggctgcgatggcgtgctgcactctggg
aaggcgtgggatgtgtgcggggtgtgtggtggagatgggtccacctgtattttgacatcc
gactcgtacagcggcggcggtgccaaagactacaacacgtttctcactctgccggtgaat
gccactcaggtccatgttgtcaacagggcgcctgtcttcactcatttagctgtgatggtc
ggggatcagtacatcgtgtctggatcgggtaccatggctctgaataccacccatccctca
ccactagatgacgactacgtagagtacagccttcacctgactcctgaccttttacccgag
atggaagaggtggtagtacctggtcctctgaaacaggagataaccatgcaggtctatcga
aaatatggaaaggaatatggtgaaaaaacaaatccaaacatcagctttcagttttatgtg
ccaagaagcaagtctttgacagacagctcacccagaggcaaatgggctccgttagcaaca
ccctgctctgtcacttgtggattgggtatacagaggaatgagcatgtctgcgtagatgaa
gacaccaacaagcttttgaagccacactactgtaaagcctctcctccacccacagcacta
cacacaacctgtcagcttccctcctgtccccccaggtgggatgcaggaaatttcggggtc
tgcagtgcctcctgtggcggcgggtttcgggtgcgtcacgtgcgatgtgttcaaaagcgt
gaacacatcgtggtaaaggttcccgattcacagtgctccacagataccgctccccaccct
gtggaaaaatgtaacctgcaccactgccctgccagatggtctgtctcagagccggggaac
tgctctgctgtgtgtggaccgggggaagcagaacgcagtgtgtcttgcgtccggcaagaa
ggcggcttagatgtcgaggtggaccacagcttttgcttaaatcagatcagacctccagat
tcggtgccatgtgtggtggacgtctgccccattgggtgggactctaagggggaggagcgg
cccagtttaaagtctggcctgcttccacgctccagacagactcctgtgtatgtctggagc
cccgtagtcagccagtgttctaggagctgtgggaatggaaccctacaggtttggttttct
tgtgtggatcaccagaccagactgggggttcctgacttccactgtgactcctccagcaaa
ccagagccgcacactgagatgtgtggtttttctccctgccctccaatgtggcgctctaag
caaggagtctgcagcgtaacgtgtggaggaggggtagccaagagagtgctgtactgtgct
agagaggcagatggagaggaggaggaggaggtgttggaggattacaactgcagcggcttt
cccaaaccaacagcagtggtttcatgtaatactcacagctgccctgcaaggtggaaggta
tttaggacgtcaccctgctccgtgtcctgtgacctgggggtagctcagaggaatgtctcc
tgtgtccagtttgtccacgggaaggagagcgtggtgccagaggacggctgccgtgcagct
gtccaacctgccaccactgtgccttgcctggtgcaagcgtgcaccttcaagtgggaggtg
aaaccatggagccagtgctcagcatcctgtggctacggtatccagtcccgagctgtgtcc
tgtatgggcccccctaagcctgagcccctcagccccctgttttgcatgcacatgcccaaa
ccgatcacaatcagaggctgcgacacgggcagctgcagagacgtggccttgaacaagacc
actcaaaccctgaaagcaaactccacggaaaagcctcttccatctcctcctccggttcat
aaagatgcgccacggcgccgcctgggcagccttcctccgaggccgacagagaccatggcc
atcgtagagactaccacagccactccaacgcctaagcctaatgcatgtggacagctactg
ctggaggaatcaggcactgtggatttgcacaatgcgccgagcagatgcacagtgtcgatt
ggtcgacccctcgacgaggtcatcagcatcacactcatatccagctctttggattgcaga
aaaagggaatacgtggcatttttcgatcgtctggcttttgtgaggaagtgtgtgcaggca
gcaggcagtgagctgaccaccagaaccaatgtcctgcttgtccggcaaagtgtggtcact
cctggaaatggagttgtgtttatctacagatcgaagaagaatacaaaaaggagtcaccat
caggattgtgacattcagctattttcccccagcggcatttttgagaatccggttacatcc
aataccagccacacctgccgagtgctcatcaacgcccctccctcggtgaagatcaggatc
caggcgctccacatagcgctaccattcaacaccactggcacccagtccacatatatcatg
atccgagacatggatgccttaaagaccaacgtgtttaacggccagcagctgttcctgtgg
cactcctctggaaatatggctgaggttgaatttcatggcgactacctgtattccaaagga
accttcagagctgaatactcctttgtgcgtctttga

DBGET integrated database retrieval system