KEGG   Poecilia reticulata (guppy): 103470698Help
Entry
103470698         CDS       T05149                                 

Definition
(RefSeq) glutathione S-transferase theta-1-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret00480  Glutathione metabolism
pret00980  Metabolism of xenobiotics by cytochrome P450
pret00982  Drug metabolism - cytochrome P450
pret00983  Drug metabolism - other enzymes
pret01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pret00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    103470698
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    103470698
   00982 Drug metabolism - cytochrome P450
    103470698
   00983 Drug metabolism - other enzymes
    103470698
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pret02000]
    103470698
Enzymes [BR:pret01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     103470698
Transporters [BR:pret02000]
 Other transporters
  Pores ion channels [TC:1]
   103470698
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_C GST_N_2 GST_C_3 GST_C_2 GST_N_4 Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 103470698
NCBI-ProteinID: XP_008417544
UniProt: A0A3P9PBR1
Position
LG9
AA seq 240 aa AA seqDB search
MEIYLDLVSPPCRAVYLFAEALKIPYAFKLVELSAGQQFTEEFGKLSVVRKVPVLKDGSF
VLTESTAILQYLVQKHSVADHWFPAELQQRARVSEYLSWQHLNLRSHCSKVFLLRTLYPF
VMGAEAPKDKMDAALGDMKQSLDLLEEKFLQDKPFIVGNKISVADLVAMVEIMQPLGAGV
DALDGRPKLTAWRDRVKKELGVKLVDQAHEALLDSSGLQQKMQNNTELQKLKPVFLKYFR
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggagatctatctggacctggtttccccgccgtgccgcgccgtctacctgttcgccgag
gcgctcaagatcccttacgccttcaagctggtggagctgtcagcagggcagcagttcact
gaggagtttggaaaactcagcgtggtgaggaaggttccggttctgaaggacggcagcttc
gtcctgacagagagcactgcgatcctgcagtacctggtgcagaaacattcggtggcagat
cactggtttccagcggagctgcagcagcgagctcgtgttagtgaatatttatcctggcag
cacctgaacctccgatctcactgctcaaaggtcttcctgctcaggactctgtatccgttc
gtcatgggcgccgaggccccgaaggacaagatggacgccgctctgggggacatgaagcaa
tccctcgacctgctggaggagaaattcctgcaggacaagcccttcatcgtcgggaacaag
atctctgtggcggatctggtggccatggtggagatcatgcagcctctgggcgccggcgtg
gacgcgctggacggccggccgaagctgacggcctggagggatcgagtgaagaaggagctg
ggagtgaagctggtggaccaggcccacgaggcgctgctggactccagcggcctgcagcag
aagatgcagaacaacaccgagctccagaagctcaaacccgtgttcctcaagtatttccgc
tga

DBGET integrated database retrieval system