KEGG   Poecilia reticulata (guppy): 103471589Help
Entry
103471589         CDS       T05149                                 

Definition
(RefSeq) tumor necrosis factor ligand superfamily member 6-like
  KO
K04389  tumor necrosis factor ligand superfamily member 6
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04010  MAPK signaling pathway
pret04060  Cytokine-cytokine receptor interaction
pret04068  FoxO signaling pathway
pret04210  Apoptosis
pret04217  Necroptosis
pret05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pret00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103471589
   04068 FoxO signaling pathway
    103471589
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103471589
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103471589
   04217 Necroptosis
    103471589
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    103471589
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pret04147]
    103471589
   04052 Cytokines and growth factors [BR:pret04052]
    103471589
   04090 CD molecules [BR:pret04090]
    103471589
Exosome [BR:pret04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   103471589
Cytokines and growth factors [BR:pret04052]
 Cytokines
  Tumor necrosis fators
   103471589
CD molecules [BR:pret04090]
 Proteins
  103471589
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNF
Motif
Other DBs
NCBI-GeneID: 103471589
NCBI-ProteinID: XP_008418903
UniProt: A0A3P9P1C7
Position
LG10
AA seq 237 aa AA seqDB search
MINTYQTSMALPQVPPPVPPRLGRPEPILIPTQLPSPGYSKPLLRFLVCVVTLHLFLSVG
GFLYLYYNERQIAHATYSSPQGRVGFPPVEKQETTYKAFARMLIGKPNAIIEKKSGYLEW
RMDLSVRKNINYYGNSWLTVLEPGDYLIYSRVTFSKHSVAPLTGCIKLRNMETGEEKEVT
KAHCSLSDKDGLNPQLCTVTLQDVITLSRGNQLSVWVENLSLVDYGKQSTSFGMYKL
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgatcaacacctaccagaccagcatggcgctgccgcaggtgcctccgccggtgccgccg
cggctcggcaggcccgagcccatcctcatcccgacccagctcccatcgccaggctacagc
aagccacttctgcgatttctggtctgcgtggtgacgctgcacttgtttctgtctgtcgga
ggttttctatacctgtactacaatgaaagacaaattgcacatgcaacatactcctcacca
caaggaagagttggttttccccccgtagaaaaacaagaaacaacctacaaagcctttgca
cgcatgttaattggaaaaccaaatgctataattgagaaaaaatctggttaccttgagtgg
agaatggacctctcagttcgcaagaacatcaactactacggcaatagctggctgacggtc
ctggagcccggtgactacctcatctactccagggtgaccttctccaagcacagcgtcgcc
ccgctgaccggctgcatcaagctgaggaacatggagacgggagaggagaaggaggtgacc
aaggcccactgcagcctgagcgacaaggacggcctgaaccctcagctgtgcacagttacg
ctgcaggacgtgatcacgctgagcagggggaaccagctctccgtctgggtggaaaacctc
tcgcttgtggactacggaaagcaatcgacgagttttgggatgtataagctgtag

DBGET integrated database retrieval system