KEGG   Poecilia reticulata (guppy): 103471681Help
Entry
103471681         CDS       T05149                                 

Gene name
htr4
Definition
(RefSeq) 5-hydroxytryptamine receptor 4 isoform X1
  KO
K04160  5-hydroxytryptamine receptor 4
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04020  Calcium signaling pathway
pret04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:pret00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    103471681 (htr4)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103471681 (htr4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pret04030]
    103471681 (htr4)
G protein-coupled receptors [BR:pret04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    103471681 (htr4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 Git3
Motif
Other DBs
NCBI-GeneID: 103471681
NCBI-ProteinID: XP_008419071
UniProt: A0A3P9NPX3
Position
LG10
AA seq 406 aa AA seqDB search
MNVSAAGQMPVMEELVSESDSMPKRMALICFLSLVMLMSVLGNLLVMVAVCKDRQLRKIK
TNYFIVSLAFADLLVSVLVMPFGAIELVHQHWIYGETFCLVRTSLDVLLTTASILHLCCI
ALDRYYAICCKPLVYRNKMTPLRVALMIGGCWVIPTFISFLPIMQGWNSIGIDHLIEERR
HNGSSNSTSCVFMVNKPYALTCSLVAFYIPLVLMVLAYQRIYITARAHALQISMLQRAGG
AGACTPGTSGSSPGVGATSESADHQRNHRMRTETKAAKTLCIIMGCFCLCWAPFFVTNVV
DPFIGYTVPEQLWTACLWLGYINSMLNPILYAFLNKSFRRAFLIILCCGRKRYRRSSIIA
TGTTCTATQINGSTHVLKYSVLHNGNHKEQNEKPLHTNIGSRESCL
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtcagcgctgcaggccagatgccggtgatggaggagcttgtcagtgagagtgac
agcatgccaaagcggatggcactcatctgcttcctgtctctggtcatgctgatgagcgtc
ttgggaaacctgctggtcatggtggccgtgtgcaaggacagacaactcaggaaaatcaag
accaactatttcattgtgtctctggcatttgctgatctgcttgtgtcagtgctggtgatg
ccgtttggtgccatcgagctggtccaccagcactggatctacggcgagacgttctgtctg
gttcggacgtcgctggacgttcttctgacaaccgcgtctattctccacctctgttgcatc
gctctagataggtactacgctatctgctgcaagccgctggtctaccggaacaaaatgacg
cccttgcgagtggctttaatgatcggtggctgctgggtcattcccactttcatctctttc
ctgcccatcatgcagggctggaacagcatcggtatcgaccacctgattgaagagaggcgc
cacaatggaagcagcaactccacttcttgtgtgtttatggtcaacaagccatacgccctc
acctgctctttggtggccttctacatccctctggtcctcatggtgctggcttaccagagg
atctacatcacggctcgcgcacacgccctgcagatcagcatgctacagcgggcaggcggg
gctggggcctgcactcctggtacctccggttcaagcccaggagtgggtgcgacttcagag
tctgctgaccatcaacgcaaccaccgtatgcgaacagaaacaaaagcagcaaagactcta
tgcatcattatgggatgtttctgcctctgttgggcaccattctttgtcaccaacgtggtg
gacccatttataggctatacagtgcccgaacagctgtggaccgcctgcctgtggctgggt
tacataaactccatgctcaaccccattctctacgccttcctcaacaaatccttccgccgt
gccttcctcatcatcctgtgttgcgggaggaagaggtatcgcaggtcatccatcattgca
acaggcacgacctgcacagccacgcagatcaacggttcaacacatgtactcaagtattct
gttcttcacaacgggaatcacaaagagcagaatgagaagcctctgcacacaaacatcggc
tcccgcgagtcctgcttgtga

DBGET integrated database retrieval system