KEGG   Poecilia reticulata (guppy): 103471825Help
Entry
103471825         CDS       T05149                                 

Definition
(RefSeq) alcohol dehydrogenase class-3-like
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret00010  Glycolysis / Gluconeogenesis
pret00071  Fatty acid degradation
pret00350  Tyrosine metabolism
pret00830  Retinol metabolism
pret00980  Metabolism of xenobiotics by cytochrome P450
pret00982  Drug metabolism - cytochrome P450
pret01100  Metabolic pathways
pret01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pret00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103471825
  09103 Lipid metabolism
   00071 Fatty acid degradation
    103471825
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    103471825
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    103471825
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    103471825
   00982 Drug metabolism - cytochrome P450
    103471825
Enzymes [BR:pret01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     103471825
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     103471825
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 Glu_dehyd_C UDPG_MGDP_dh_N TrkA_N Tic110
Motif
Other DBs
NCBI-GeneID: 103471825
NCBI-ProteinID: XP_008419255
UniProt: A0A3P9P0I8
Position
LG10
AA seq 382 aa AA seqDB search
MATTGQVIRCMAAVAWEPRKPLSIEEVDVAPPKAHEVRIKVVASGVCHTDWEYLYEAGRG
MSLRPFPVVLGHEAAGVVESVGPDVTKFAPGDKVIPLFLPFCEECDQCKCEKTNLCKKNW
ENTQAGVLADGTSRISCRGQQVYQFLGVSSFCQYTVVPDTSLAKINPKAPLEKVCLLGCG
VSTGYGAAVKTGKVEEGSCCAVFGLGAVGLAAVMGCQAAKARRIIAVDINPDKFQKAREF
GATECINPRDYGNKPIQEILVEKTNGGVDYALECVGSPVTMSAALESTRDGCGTCVIAGW
TETESMSVKVIKILMGRTLKGTYFGGWKSAKDVPQLVEDYMQKKLKLDEFISHNLPLAQI
NNAFDLLRNGQSIRTVISLDDF
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atggcaacaacaggacaggtaatcagatgcatggcagctgttgcttgggagcccaggaag
cctctttctattgaagaagtggatgttgcccctcctaaggctcatgaagtccggatcaag
gttgttgcctcaggcgtgtgccacacagactgggaatacctgtatgaggccggaagagga
atgagcctccgacctttccctgtggttctgggacatgaagcagcaggtgtagtggagagt
gttggcccagatgtaaccaagtttgcaccgggggataaagtcattcctctttttcttccg
ttttgtgaagagtgtgaccagtgtaaatgtgagaaaacaaacctctgcaagaagaactgg
gaaaacacacaagcgggtgttttggctgacgggacgagcagaatatcttgcagaggtcag
caggtctaccagttcctgggtgtcagctccttctgtcagtacacggtggttcccgacacg
tctctggcgaagataaaccccaaggctccactggaaaaagtctgcctgctgggctgcggc
gtctccactggttacggtgcggctgttaaaaccgggaaggttgaggaaggttcctgctgt
gccgtgttcggactcggagcggtgggtctggctgccgttatgggctgccaggcggccaag
gccagaaggatcatcgcggtcgacatcaaccctgacaagttccagaaagccagagagttt
ggagcgacagagtgtatcaaccccagagattatggaaacaagcccatccaggagattctg
gtggagaagaccaacgggggggtggactatgctctagagtgtgttggcagtccagtcacc
atgagcgctgcactggagtccacaagagacggctgcgggacatgcgtcattgctgggtgg
acagagacggagtcgatgagcgtcaaggttataaagatcctgatggggcgcaccctgaag
gggacttactttggaggttggaagagtgcgaaggacgttcctcagctggtggaggattac
atgcagaagaagctgaagctggatgaatttatcagccataacctcccgctggctcagatc
aacaacgccttcgacctgctgagaaacggtcaaagtatccgaacagtcatcagtctggac
gacttctga

DBGET integrated database retrieval system