KEGG   Poecilia reticulata (guppy): 103471853Help
Entry
103471853         CDS       T05149                                 

Gene name
qdpr
Definition
(RefSeq) dihydropteridine reductase
  KO
K00357  dihydropteridine reductase [EC:1.5.1.34]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret00790  Folate biosynthesis
pret01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pret00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    103471853 (qdpr)
Enzymes [BR:pret01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     103471853 (qdpr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 Epimerase Nitro_FeMo-Co
Motif
Other DBs
NCBI-GeneID: 103471853
NCBI-ProteinID: XP_008419309
Position
LG10
AA seq 235 aa AA seqDB search
MANRVIVYGGRGALGSKCVQHFKSKGWWVASVDIAANEEANENIIVKLTESFTDQAGQVT
ADVAQLLGESKVDAILCVAGGWAGGNCSSKDFFKNSDLMWKQSVWTSTISSHLAARHLKS
GGLLTLAGAKAAQSGTGGMVGYGMAKAAIHQLCQSLAAKNSGMPAGAAAVAVLPVTLDTP
MNRKFMPDADYSSWTPLEYIAEMFFGWATGENRPASGSLMQLLTSGGETQAVAAQ
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaccgggttattgtgtacggagggagaggcgctctgggctcaaagtgtgttcag
cattttaaatctaagggatggtgggtcgccagtgtcgacattgctgctaatgaggaggcg
aatgaaaacataatcgtgaagttgactgaatctttcaccgatcaggcaggacaggtgacg
gcagatgtggcccagctgctgggggaaagcaaagtggatgccatcctgtgtgtggcaggc
ggatgggctggagggaactgcagttccaaagattttttcaagaactctgatttgatgtgg
aaacaaagcgtgtggacgtccaccatctccagccacctcgccgctcgccatctgaaatct
gggggtctgctcaccttggcaggagcaaaagcagctcaatcgggcactggaggtatggtg
ggctacggcatggccaaagctgccatccaccaactgtgtcagagtctggcagcaaagaac
agtggcatgccggcaggagcggcagctgttgctgtcctacccgttaccttggatacaccg
atgaacaggaagttcatgcctgatgcagactacagctcgtggacgccgctggaatacatt
gcagaaatgttctttggctgggccacaggggagaaccgacccgcttcaggaagcctgatg
cagcttctgacctccggaggagaaactcaggctgtggccgctcagtag

DBGET integrated database retrieval system