KEGG   Poecilia reticulata (guppy): 103473357
Entry
103473357         CDS       T05149                                 

Gene name
dck
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret00230  Purine metabolism
pret00240  Pyrimidine metabolism
pret01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pret00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    103473357 (dck)
   00240 Pyrimidine metabolism
    103473357 (dck)
Enzymes [BR:pret01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     103473357 (dck)
SSDB
Motif
Pfam: dNK AAA_33 AAA_18 AAA_28 Thymidylate_kin AAA_17
Other DBs
NCBI-GeneID: 103473357
NCBI-ProteinID: XP_008421756
UniProt: A0A3P9Q8P1
Position
LG12
AA seq 263 aa
MPAIPKRPCPDPMNDSMEKRITRISIEGNIAAGKSTFVRLLEQESTDWEVVPEPIARWCN
VQTTGSDFKELTTSQRSGGNVLKMMYEKPERWAYTFQSYACISRVRAQIKSANGKLQEAE
NPVLFYERSIYSDRYIFAGNLYESECMNETEWSIYQDLHGWLHNQFGKHIELDGIIYLRA
SPEKCLERLHMRGRQEEQEIPLEYLEKLHYKHESWLQNKTMNMEFEYLSDVPVLTLDVND
DFKQNDSKTADMIEKVKEFLSTL
NT seq 792 nt   +upstreamnt  +downstreamnt
atgcctgctataccgaagagaccttgccctgacccaatgaatgactctatggagaagaga
ataacgcgcatttcaatcgaaggaaacattgcggctgggaagtctacttttgtgcgcctt
ttggagcaggagagcacggattgggaggtagtaccggaaccgatcgctagatggtgcaat
gtccaaacaacaggcagcgactttaaggagctgaccacgtctcagaggagcggcggcaac
gtgttgaagatgatgtacgagaagcctgagaggtgggcttacacattccagagctacgcc
tgcatcagccgagtgcgcgcccagatcaaatctgcaaacgggaagctccaagaggctgag
aatcccgtgttgttctacgagagatccatctacagtgacaggtacatctttgcaggcaac
ctatatgagagtgaatgcatgaatgagactgaatggtccatctaccaggacttgcatggc
tggcttcacaaccagtttggcaaacacattgagctagatggtatcatctacctcagagct
tcaccagagaaatgcttggagcgtttacacatgaggggaagacaggaggaacaggaaatc
cctctggaatacctggagaagctccactacaagcatgagagctggctgcagaataagaca
atgaacatggagtttgagtatctcagcgacgttcccgttctgaccttggacgtgaacgac
gattttaagcaaaacgattcaaagactgctgacatgattgagaaggtgaaggagttcttg
agcacattgtga

DBGET integrated database retrieval system