KEGG   Poecilia reticulata (guppy): 103473561Help
Entry
103473561         CDS       T05149                                 

Definition
(RefSeq) 5-hydroxytryptamine receptor 4-like
  KO
K04160  5-hydroxytryptamine receptor 4
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04020  Calcium signaling pathway
pret04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:pret00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    103473561
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103473561
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pret04030]
    103473561
G protein-coupled receptors [BR:pret04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    103473561
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 DUF2244 TMEMspv1-c74-12
Motif
Other DBs
NCBI-GeneID: 103473561
NCBI-ProteinID: XP_008422104
Position
LG12
AA seq 399 aa AA seqDB search
MATASPQHFLDDVINNGQQEQQGFLSSWETIFLTIFLSVIIILTVFGNLLVMVALCKDRH
LRRKKTSFFIVSLAFADLLVALFVMPLAAIELTTGQWHFGEIFCLVRTSLDVLLTTASIL
HLCCIALDRYYAICCQPLVYRSKMTPVRVALMLIGCWVIPTFISFLPIMQKWNTIGIENI
IEEKQSLSGGSNTSCVFLVNQPYALICSAVAFYIPLALMVLAYHRIYVTAMVHVRQIETL
QRAGSVPITCSDHVLTIRSSTSSGPLNHYGLRTATVSLSSEQAQGRHRRMRIETRAAKTL
AIIMGCFSLCWAPFFITNVVDPFINYSVPWQVWTAWLWLGYINSGLNPFLYAYLNQAFRR
AFLAILCCGDERYTQQGICSNGLSRASVPSVNGTSMALR
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggccacagcatcacctcagcattttttggacgacgtgataaataatggacagcaggag
cagcaaggattcctgagctcttgggagaccatttttctcaccatcttcctttccgtcatc
attattttgactgtgtttggcaacctgttggttatggttgctctctgcaaggacaggcac
ctgaggcgaaaaaagaccagcttcttcatcgtctctctggcgttcgctgacctgctggtt
gcgctgtttgtgatgccccttgctgccatcgagctaaccaccggccagtggcactttgga
gaaattttctgcctggtgcgaacctctctggatgttttattgaccacagcatccatcctt
cacctctgctgcattgcactggacagatactacgccatctgctgccagccgctggtctac
agatctaagatgaccccagtccgagtggcacttatgctcatcggttgctgggtcatcccc
acatttatctccttcctacccatcatgcaaaagtggaacactattgggatagagaacatt
attgaagagaaacaatccctttcgggaggctccaacacaagttgtgtgtttctggtcaac
cagccatacgccttgatctgctctgccgttgccttctacatacccctggccctcatggtt
ttggcctatcaccgcatctatgtcaccgccatggtccacgtcaggcagatagagactctg
caacgtgccggctccgtcccgattacatgttcggaccacgtcttaaccatacggtcttcc
acctcctcgggtccgctgaatcactacggcctgaggacagcgactgtgtccttgtcctca
gaacaggctcaaggaagacacagacgcatgcgcattgagacgagggcagcaaagacactg
gcgatcataatgggctgcttctccctgtgctgggcgccatttttcatcacgaacgtggtg
gaccccttcattaattactctgtaccctggcaggtgtggacagcctggctgtggctggga
tacattaactcaggactgaaccccttcctgtacgcctacctgaaccaggcttttcgaagg
gcgttcctggcgattctctgctgcggagacgaacgttacactcagcaggggatctgctcc
aatgggctcagcagggcctccgtcccgtcggtcaatgggacctccatggctctgaggtaa

DBGET integrated database retrieval system