KEGG   Poecilia reticulata (guppy): 103474425
Entry
103474425         CDS       T05149                                 

Gene name
mecom
Definition
(RefSeq) MDS1 and EVI1 complex locus protein EVI1 isoform X1
  KO
K04462  ecotropic virus integration site 1 protein
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:pret00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103474425 (mecom)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pret03000]
    103474425 (mecom)
Transcription factors [BR:pret03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    103474425 (mecom)
SSDB
Motif
Pfam: zf-C2H2 zf-C2H2_4 zf-H2C2_2 zf-C2H2_6 zf-C2H2_jaz zf-H2C2_5 zf-C2H2_8 zf-BED PyrI_C
Other DBs
NCBI-GeneID: 103474425
NCBI-ProteinID: XP_008423578
Position
LG13
AA seq 1262 aa
MRSKGRARKLATSDGNDDFGFFPSNVLDNACGSDGDPTPSLALTDEPLSDDESSPQSLQQ
ASIFFPQGNLIIPLDFELRESAVPGASLGIWSRRKVNIGERFGPYEGEHAPCLQDPMQGW
EILDGSGHVKFCLDASKPDAGSWLKHIQFAPAATQHNLRACQIDEQIFYKVTREIFPGEE
LLLFMKAEEYFCDAMAPDIHEERQYRCEDCDQHFESRNELLDHQKEPCGMPPSAFLNPGG
DSDLTAQEPQDLRPLHMSHGLHECKECDQVFPDVQSLENHSQSHSEEREYKCDQCPKAFN
WKSNLIRHQMSHDSGKHYECENCSKQVFTDPSNLQRHIRSQHVGARAHACSDCGKTFATS
SGLKQHKHIHSSVKPFMCKSLRPYLCEVCHKSYTQFSNLCRHKRMHADCRTQIKCKDCGQ
MFSTTSSLNKHRRFCEGKNHFTAGGLFAQGLPLPGTPGLDKSALTLGHSSAGLADYFGAS
RHHSGLTFPAAPAFPFSFPGLFPSGLYHRPQLIPATSAPVRQTAHAPVTGPGVELSKSPL
LPPSPGALESQELLKALCKNGSSPGNDMQDSELPNQGSSVSAKQQNKQSDLSESSDVDDV
STPSGSDLESTTGSELESDMDSEKERGVARENGKGPRRKATERDPQSPSLIGSSTAKGFP
GQSLIQSSLDEHTAVTGAVNDSIKAIASIAEKYFGSAGLAGLQDKKVGSLPYPSMFPLPF
FPTFSPPVYPLPDRDLRPTGVKGEPQSPGDDCKKAQSKSSESPFDLTTKRKEGKLSLFVP
TKTDAANVTGQDQPLDLSLGSRGRGQIPCQEETRKNKSFEEEKRAVDAPKADTSLQHARP
TPFFMDPIYSRVEKRRMSDPFETLKDKYMRPTPGFLFHPQFRLPDQRTWMTAIESMAEKL
ETFGSLKPESGELLRSVPSMFDFRAPPSTLPETLLRKGKERYTCRYCGKIFPRSANLTRH
LRTHTGEQPYRCKYCDRSFSISSNLQRHIRNIHNKEKPFKCHLCDRCFGQQTNLDRHLKK
HENGHLSGTAMSSPQSELDSSSAILDDKEDSYFNEIRNFISSASQNQTSPDPSEEGLNGG
LLEEGKPLMPSHGPRDLEDEEAEDLDAEEEEAEEPRNSPPKTDVKVHPVSVGDDEMDFSE
PSDLNLSCKTSPRRYSHEEEQSSFSALDHIHRFSDLRKMDESEVSDGDGDGDEDDGSFAS
PSLAKAVKQPLFRKSKSQAYAMMLSLAEKDSLHSAPHTPATMWHSLARAAAESSAIQSLS
HV
NT seq 3789 nt   +upstreamnt  +downstreamnt
atgaggtccaaaggcagggcgcggaaactggccacgagcgatggcaacgatgactttggc
ttctttccaagcaacgtgttggacaacgcatgtggctccgatggcgatcctacaccttcc
ttagccctgacagacgagccgctttctgacgatgagtcctcacctcagtcacttcaacaa
gcaagcatcttttttcctcaaggcaatttaatcattcctctggactttgagctgagagag
tcagcagttccaggtgcaagtctgggtatctggagccgcaggaaggtgaatataggagaa
cgctttggaccatatgagggggagcacgccccatgtctccaagaccctatgcagggctgg
gagatcttggatgggtcaggccatgtaaagttctgcctggatgccagcaaaccagacgca
gggagctggctgaagcacatccagtttgcccctgcggccacgcagcataacctgagagcg
tgccagatagatgagcagatcttctacaaagtcactagagagatttttcctggcgaggaa
ctactacttttcatgaaggctgaagagtatttctgcgacgcaatggctcctgatattcat
gaggagaggcagtaccgctgtgaggactgcgaccagcactttgagtcccgcaacgagttg
ctggatcaccagaaggagccgtgtgggatgcccccctctgctttcctcaacccaggaggg
gactctgacctgacagctcaagaacctcaagatttgcggccccttcatatgtctcatggc
ctacacgagtgtaaggagtgtgaccaggtcttccctgatgtccagagtttggagaaccac
agtcagtcgcactctgaggagagggaatacaagtgcgatcagtgtcccaaggctttcaac
tggaaatcaaacttgatccgacatcaaatgtcgcatgacagtggcaagcactacgaatgt
gaaaactgctcaaagcaggtgttcacagaccccagtaacctgcagaggcacattcgctct
cagcacgtcggggctcgggcccatgcctgctccgactgcgggaagacgtttgcaacgtct
tcgggcctcaagcagcataagcacattcacagcagtgtcaagcccttcatgtgtaagtca
ctaagaccctacctatgtgaggtatgccacaagtcctatacccagttctctaacctttgc
cggcacaaacgcatgcatgctgactgtcgcacacagataaaatgcaaggactgtgggcaa
atgttcagcaccacctcgtccctcaacaaacatcggcgcttctgtgaaggaaagaatcac
ttcacagcaggggggttgtttgcgcagggcctaccactccctggtacccccggcttagac
aaatcggctctcacgctcggtcacagcagcgctggacttgctgattacttcggcgcaagc
cgccaccatagtgggctcactttccctgcagccccagcatttcctttcagcttccccggc
ctgtttccttctggactatatcaccggccacagctcattcctgccacctccgctcctgtc
agacagacggctcatgcacctgttacagggcctggtgtggaactaagcaaaagtcctttg
cttcctccgagccctggcgctctggagtctcaagaactgttaaaagctctgtgcaaaaat
ggcagttcacctggaaacgacatgcaagactcagaacttcccaatcagggctcctctgtg
tccgcaaagcagcagaacaagcaaagtgacctgtctgaaagcagcgacgtggacgacgtc
agcacgccgagtgggagtgaccttgagagcacaacgggctctgaactcgaaagcgacatg
gacagtgaaaaggagaggggagttgctcgagaaaatggcaaaggtcccaggagaaaggcc
actgagagagaccctcaaagtcccagcttgataggaagcagtactgctaaaggctttcca
ggccagtccctcatacagtcgtcactagacgagcacacggctgtaacaggggctgtaaat
gactctattaaggccattgcctctattgcagaaaaatattttggctcagcagggctggct
ggcttgcaggacaagaaggttgggtctttgccctacccctctatgtttccactgcctttc
ttcccgactttctctccaccagtttaccccttgccagacagggacctcagaccaacaggc
gtgaagggcgagccacagtcgccaggagatgactgcaagaaggctcagagcaagtcatct
gagtcaccatttgacctcactaccaagcgaaaggagggcaaactgtccctgtttgttccc
accaaaaccgatgctgcaaacgttactggccaggaccagcctctcgatctgagcctgggc
tcccggggccgtggacagattccgtgtcaggaggagaccaggaagaacaagagctttgaa
gaggagaagagagcagtggatgctcctaaagcagacacctccttacagcatgccaggccc
accccttttttcatggaccctatctacagcagggttgagaagaggagaatgagcgatccg
tttgagactctgaaagacaagtacatgcggccaactccaggcttcctcttccatccacaa
tttcgtttgccagatcagagaacttggatgacggccattgagagcatggcggagaagctg
gagacctttggctccttgaagccagagtcaggagaactgctgcgctccgtcccgtccatg
ttcgacttcagagctccgccctccactcttccagagacactgttgcgcaagggcaaggag
cgctacacatgcagatactgtggaaaaatattccctcgttctgccaacctgactcgccat
ctcaggactcatactggagagcagccatacaggtgtaaatactgcgaccgctccttcagc
atctcctccaacctgcagcggcacattcgcaacattcacaacaaggagaagcccttcaag
tgccacctgtgcgaccgctgcttcggccagcagaccaaccttgaccgccacctcaaaaag
catgaaaacggccacctgtcaggaactgcaatgtcatccccgcagtcggagttggacagc
agcagtgccatattggacgacaaagaagactcctatttcaatgaaataagaaattttatt
agcagcgcaagtcagaaccagacatcaccagacccatctgaagaagggctaaacggaggc
ctgctggaggaggggaaacccctgatgcccagccacggaccacgtgacctggaagatgag
gaagcagaagacctggatgctgaggaggaagaagcagaggagccgaggaacagtcctccg
aagacagacgtcaaggtgcatcccgtcagcgtcggcgacgatgaaatggacttcagtgag
cccagcgacttaaacctcagctgcaaaacctctccgaggaggtattcacatgaggaggaa
cagagcagcttctcagctttggatcacatccatcgtttctcggatctgcgcaaaatggat
gagagcgaggtgagtgatggagacggagatggagatgaggacgatggatccttcgcctcc
ccatcactcgccaaggcagtcaaacagccgctctttaggaaatccaagtctcaggcgtat
gccatgatgttgtctctggccgaaaaggactctctccactccgccccccacaccccggcc
accatgtggcacagtctggcacgggctgcggctgaatccagtgccatccagtccctcagc
cacgtatga

DBGET integrated database retrieval system